FCC Web Documents citing 4.2

as compiled by hallikainen.com/FccRules on 2012 07 01

• http://esupport.fcc.gov/index.htm?job=upload_help_2
  • [6]E-Filing [7]Initiatives [8]Consumers [9]Find People Support Attachment Help Maximum Attachments and Size You can attach up to six (6) files. The attached files can have up to a total file size of 10.0MB each. * [10]Accepted Word Processing Formats * [11]Accepted Spreadsheet Formats * [12]Accepted Presentation Formats Accepted Word Processing Formats * ASCII Text * ANSI Text * Applix Words v4.2 * Applix Words v4.3 * Applix Words v4.4 * Executables * HTML v1.x * HTML v2.x * HTML v3.x * HTML v4 * IBM DCA/RFT vSC23-0758-1 * IBM Displaywrite v4 * IBM Displaywrite v5 * Lotus AMI Pro v2 * Lotus AMI Pro v3 * Lotus AMI Professional Write Plus * Lotus Word Pro v96 * Lotus Word Pro v97
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-06-2365A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-06-2365A1.pdf
  • 195 ¶ 86. . We note that the Region 41 General Use wideband channels are not included in the instant Plan. Therefore, a Plan Amendment will have to be submitted and approved by the Commission before the wideband channels may be licensed. 47 C.F.R. § 90.527. . See supra note 2. Plan Section 4, Notification Process at 9; Plan Section 4.2, Election of Officers at 10, and Plan Section 5.1, Subcommittees at 11. Region 41 formed three subcommittees, Implementation and Technology, Interoperability, and 4.9 GHz. Plan Appendix H - Bylaws (revised April 2004). ). Plan Section 4.0, Notification Process at 9 (describing efforts to increase awareness and visibility for the planning process). Plan Supplement - Meeting Attendance (submitted Mar. 8, 2006).
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.pdf
  • Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications Commission, dated July 13, 2005 (attaching the affidavit of Caroline Beasley, Vice President and Chief Financial Officer of Beasley Broadcast Group) filed
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-1094A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-1094A1.pdf
  • Table C5 are considered to fall outside of the U.S./Canada border area and may operate according to the non-border band plan listed in § 90.617. TABLE C5 - CITIES THAT ARE CONSIDERED TO FALL OUTSIDE THE CANADA BORDER REGION Location Coordinates Latitude Longitude Akron, Ohio Youngstown, Ohio Syracuse, New York 41( 05' 00.2" N. 41( 05' 57.2" N. 43( 03' 04.2" N. 81( 30' 39.4" W. 80( 39' 01.3" W. 76( 09' 12.7" W. (6) The channels listed in Table C6 and paragraph (c)(6)(i) of this section are available in the Canada Border Regions for non-cellular operations to eligible applicants in the Public Safety Category which consists of licensees eligible in the Public Safety Pool of subpart B of this part.
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2088A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2088A1.pdf
  • see also Plan, Appendix C - List of Meetings Held at C1; Plan, Appendix D - Meeting Minutes and Announcements at D1-D74. See Plan, Section 3 - Allocation of General Use Spectrum at 14-16; see also Plan, Section 3.4 - Region 13 Application Requirements at 18-19. See Plan, Section 4.0 - Processing and Evaluating Applications at 24-28. See Plan, Section 4.2 - Evaluation Matrix Point System (scoring based on system type, implementation factors, intersystem interoperability, loading requirements and system density/geographic efficiency). See Plan, Appendix J - Letter dated October 31, 2001 from Governor George H. Ryan, State of Illinois to D'Wana Terry, Chief, Public Safety and Private Wireless Division, Wireless Telecommunications Bureau, FCC (affirming Illinois Statewide Radio Communications Steering Committee (I-STAR)
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-442A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-442A1.pdf
  • band plan for Canadian Border Regions 7A and 7B as indicated below. TABLE C5 - CITIES THAT ARE CONSIDERED TO FALL WITHIN CANDIAN BORDER REGION 7 Location Coordinates Canadian Border Region Latitude Longitude Akron, Ohio 41( 05' 00.2" N. 81( 30' 39.4" W. 7A Youngstown, Ohio 41( 05' 57.2" N. 80( 39' 01.3" W. 7A Syracuse, New York 43( 03' 04.2" N. 76( 09' 12.7" W. 7B * * * * (7) * * * TABLE C7 - GENERAL CATEGORY 806-821/851-866 MHz Band CHANNELS IN THE CANADA BORDER REGIONS. Canada Border Region General Category channels where 800 MHz high density cellular systems are prohibited. General Category channels where 800 MHz high density cellular systems are permitted. * * * * *
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.pdf
  • at 27-42 (seven meetings held over the course of a six-year period). See Revised Plan, Section 4.1.a Procedure for Requesting Spectrum Allocations at 6; see also Revised Plan, Section 4.3 Allocation of Narrowband ``General Use'' Spectrum (narrowband pool allotments have a channel bandwidth of 25 kHz to provide flexibility to accommodate multiple technologies using multiple bandwidths). See Revised Plan, Section 4.2 Procedure for Frequency Coordination at 8. See Revised Plan, Section 5.0 System Design/Efficiency Requirements (interference protections criteria, spectrum efficiency standards and the handling of ``orphaned'' channels) at 13-14. Revised Plan, Section 6 Interoperability Channels (addressing tactical channels, deployable systems and the monitoring of Calling Channels); see also Revised Plan, Appendix E - NCC Implementation Subcommittees Table of Interoperability Channels. See
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1258A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1258A1.pdf
  • 9, 2009) (``LOI Response''). 47 C.F.R. § 4.9(f). See also supra, ¶ 4. 2004 Network Outage Order, 19 FCC Rcd at 16868 ¶ 69. See id. at 16834 ¶ 3, 16868 ¶¶ 73-75. In the 2004 Network Outage Order, the Commission afforded confidential treatment to network outage reports. 2004 Network Outage Report, 19 FCC Rcd at 16853-55, ¶¶ 42-46. Section 4.2 of the Rules specifically states that Part 4 outage reports ``will be presumed to be confidential'' and that public access to outage reports may be sought only pursuant to the procedures set forth in Section 0.461 of the Rules which addresses requests for inspection of materials not routinely available for public inspection. 47 C.F.R. § 4.2; see also 47 C.F.R.
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1607A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1607A1.pdf
  • in the development of coordinated regional plans, and developed a Regional Planning Guidebook. Following the sunset of the NCC's charter on July 25, 2003, the National Public Safety Telecommunications Council (NPSTC) agreed to continue to provide assistance to regional planners. A copy of the 700 MHz Regional Planning Guidebook is available at the NPSTC website at http://www.npstc.org/nccsubcom.jsp. See Plan, Section 4.2 - Information and Notification Process at 13 (notifications were published by FCC public notice and posted on the Oregon Chapter APCO website at http://www.oregonapconena.org. Region 35 maintains a website at http://www.region-35.org for all meeting agendas, minutes and key resource documents. See Plan, Appendix B - By-Laws of Region 35. See Plan, Appendix C - Region 35 Membership; see also Appendix
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-220A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-220A1.pdf
  • the People of the State of California for Rulemaking on States' Access to the Network Outage Reporting System (NORS) Database and a Ruling Granting California Access to NORS, ET Docket No. 04-35 (Nov. 12, 2009) (CPUC Petition). 47 C.F.R. § 1.401. See CPUC Petition. 47 C.F.R. § 1.41. CPUC Petition at 1, 13-20. 47 C.F.R. Part 4. 47 C.F.R. § 4.2. New Part 4 of the Commission's Rules Concerning Disruptions to Communications, Report and Order and Further Notice of Proposed Rulemaking, ET Docket No. 04-35, 19 FCC Rcd 16830, 16856, ¶ 47 (2004) (Part 4 Report and Order). See CPUC Petition at 3-4; see also Part 4 Report and Order, 19 FCC Rcd at 16848, ¶ 32 (emphasis added). CPUC Petition
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2342A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2342A1.pdf
  • operational functions by at least fifty users. Waiver Order at ¶ 47. See Alcatel-Lucent Ex Parte Filing, PS Docket 06-229 at 3 (filed Aug. 18, 2010) (``Public Safety Broadband Interoperability Recommendations: FCC Interoperability Vendor Meeting''). See, e.g., 3rd Generation Partnership Project; Technical Specification Group Services and System Aspects; Network Sharing; Architecture and functional description (Release 9), 3GPP TS 23.251 at 4.2.1 (2009). . See Public Safety and Homeland Security Bureau Seeks Comment on Interoperability, Out of Band Emissions and Equipment Certification for 700 MHz Public Safety Broadband Networks, PS Docket 06-229, Public Notice, 25 FCC Rcd 5486 (PSHSB 2010) (Technical Public Notice). See id. at 5487; see also NPSTC BBTF Report at 6.3.1. See Technical Public Notice at 5487-88. See Alcatel-Lucent
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DOC-275666A1.pdf
  • DTV Signal Detection Threshold.....................................12 3.2.1 Baseline Detection Threshold Tests (Single DTV Input Signal)..........................................12 3.2.2 Multiple-Signal Detection Threshold Tests (Two DTV Input Signal).................................15 3.3 Field Tests with Over-the-Air Signals.......................................................................................18 3.3.1 Field Test Site 1....................................................................................................................20 3.3.2 Field Test Site 2....................................................................................................................25 3.3.3 Field Test Site 3....................................................................................................................29 3.3.4 Field Test Site 4....................................................................................................................33 3.4 Field Test Summary...................................................................................................................37 4 Transmitter Emissions Characterization Measurements..............................................................39 4.1 Transmitter Description............................................................................................................39 4.2 Measurement Approach.............................................................................................................39 4.3 Measurement Equipment Configuration...................................................................................40 4.4 Channel Consistency Test..........................................................................................................42 4.5 Fundamental Channel Emissions Measurements......................................................................44 4.6 Out-of-Channel Emissions Measurements................................................................................46 4.7 Emissions Characterization Data Summary..............................................................................47 5 Over-The-Air Interference Test.......................................................................................................49 5.1 Test Approach...........................................................................................................................49 5.2 Test System................................................................................................................................51 5.3 Test Procedure..........................................................................................................................54 5.4 Test Results................................................................................................................................54 iii 6 Data Observations Relevant to TV Services...................................................................................56 6.1 Scanning/Spectrum Sensing Capability Tests............................................................................56 6.1.1 Prototype A Results..............................................................................................................56 6.1.2 Prototype B
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.pdf
  • for Determining Proposed Regional PSAPs in Oklahoma...................................................12 3.5.2 PSAP Regionalization Example: South West Oklahoma Regional 9- 1-1 Association.....................13 3.5.3 Proposed Regi onal PSAPs........................................................................................................ ......16 3.5.4 Regional PSAPs Map............................................................................................................. .........20 3.5.5 Oklahoma E9-1-1 Implement ation/Upgrade Summary....................................................................21 3.5.6 High-Level Tasks for Regionalizing and Im plementing E9-1-1........................................................29 4. OTHER E9-1-1 ISSUES AND RECOMMENDATIONS........................................................................................ 31 4.1 E9-1-1 AND THE AMERICANS WITH DISABILITIES ACT (ADA)..............................................................................31 4.2 E9-1-1 AND MULTI-LINE TELEPHONE SYSTEMS (MLTS)....................................................................................31 4.3 E9-1-1 AND THE OKLAHOMA HIGHWAY PATROL FIELD TROOP COMMUNICATION CENTERS.................................33 4.4 E9-1-1 IN RELATION TO DEPARTMENT OF HOMELAND SECURITY PROGRAMS .....................................................34 4.4.1 Radio Intero perability......................................................................................................... ..............34 4.4.2 Next Generation 9-1-1 (NG9-1-1)....................................................................................................34 4.4.3 Evolution to a Next Generation 9-1-1 Syst em.................................................................................35 4.4.4 Next Generation 9-1-1 Benefits................................................................................................. ......35 4.4.5 Leveraging Existing Oklaho ma Assets for
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-02-108A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-02-108A1.pdf
  • in the J-Standard would be extremely onerous for carriers because it would require carriers to subvert normal call processing needs and buy additional equipment solely to accommodate surveillance activities. Such a result would not be cost effective. In the words of the statute, post cut-though dialed digits are not reasonably available from the originating carrier'' (emphasis in original). J-STD-025 § 4.2.1. Webster's New World Dictionary, College ed. (1962.) at 101. Although commenters discuss the hardware modifications that will be required to collect this information - i.e. the installation of tone decoders - none argue that the basic structure of the network will not allow for the provision of a dialed digit extraction capability. See also Third R&O, supra n.2, at ¶¶
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.pdf http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.txt
  • 2004, at 10. Luiz Carvalho et al., A Look at Wireless Data: Don't Short SMS, Morgan Stanley, Equity Research - Wireless Telecom Services, Mar. 2, 2003, at 3. Cingular Wireless reported it had 5 million customers ``actively using'' its mobile data services as of the end of 2002, up from 2 million data customers at the end of 2001. Approximately 4.2 million of the 5 million were accessing data services over Cingular's cellular/PCS networks, and the rest were served by its Mobitex network. Cingular Wireless, LLC, SEC Form 10-K, Mar. 11, 2003, at 3, 5. Verizon Wireless Announces Roll Out of 3G Network in Las Vegas, Press Release, Verizon Wireless, July 27, 2004. AWS Launches UMTS in Four Markets, RCR Wireless
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-17A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-17A1.pdf
  • connections in service, as reported on FCC Form 477, has increased rapidly, from 380,000 in June 2005, to 3.1 million in December 2005, and to 11 million in June 2006. Interconnected VoIP subscribership in the United States also appears to have grown rapidly since the 2004 Data Collection Order was adopted, reportedly increasing from 1.2 million subscribers in 2004 to 4.2 million subscribers at the end of 2005, and to over 8 million subscribers by September 2006. In a separate proceeding, we have explained that the growth of interconnected VoIP services is one of the changing market conditions that are placing under significant strain the existing system to preserve and advance universal service, which is a fundamental goal of communications policy
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.pdf http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.txt
  • three sets of radio frequency bands: the 2 GHz MSS band (the 1990-2025 MHz uplink and the 2165-2200 MHz downlink), the L-band (general designation for frequencies from 1 to 2 GHz) and the Big LEO bands (referring to the 1.6/2.4 GHz bands). See Staff Report at ¶ 76. See supra ¶ 11and note 31. ANSI C63.19-2007 Standard at 18, Table 4.2. 700 MHz Service Report and Order, 22 FCC Rcd at 8119 ¶ 148. See Hearing Aid Compatibility Order, 18 FCC Rcd at 16779 ¶ 63 (not discussing the inclusion of additional services, air interfaces, or frequency bands). The Chief, Wireless Telecommunications Bureau, in coordination with Chief, Office of Engineering and Technology, does have delegated authority to approve revised versions of
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-99A1.pdf
  • and for an arrival angle of 45 degrees only if the 3650 MHz transmitter is at least 600 meters away. According to SIA's calculations, a sufficient C/I ratio will never be achieved if the transmitter is 1000 meters away and the arrival angle of the 3650 MHz signal is 15 degrees or less. 119SeeTHEODORE S.RAPPAPORT,WIRELESS COMMUNICATIONS PRINCIPLES &PRACTICE138-39, & Tab. 4.2 (2d ed. 2002) (proper path loss exponent for exterior environments is between 2.7 and 5); PROPAGATION OF RADIO WAVES 191-192 (Les Barclay, ed., 2d ed. 2003). 120The acceptable range for C/I margin under the different conditions of separation distance and satellite arrival angle is shown in Attachment B to SIA's petition for reconsideration. It's C/I margin calculations there still indicate
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-09-20A1.pdf
  • will not receive interference or that any particular transmission from this transmitter will be free from interference." We seek comment on this language, which tracks the existing MICS/MedRadio requirement. 54See §2.1093 (c). The limits to be used for evaluation are based generally on criteria published by the American National Standards Institute (ANSI) for localized specific absorption rate ("SAR") in Section 4.2 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1­1992, Copyright 1992 by the Institute of Electrical and Electronics Engineers, Inc., New York, NewYork 10017.See §2.1093 (d). 55Proposed Changes in the Commission's Rules Regarding Human Exposure to Radiofrequency Electromagnetic Fields, ET Docket No. 03-137, Notice of Proposed
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-10-63A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-10-63A1.pdf
  • comment on how to ensure that a certification authority can be limited to a workable size without having the unintended result of arbitrarily restricting the participation of interests that should be involved in the authority's activities. We also seek comment on the applicability to the certification authority of the membership criteria set out in International Standard ISO/IEC 17011(E), particularly sections 4.2 (Structure) and 4.3 (Impartiality). Assuming a certification authority possessed the significant degree of autonomy on which we seek comment, would it be necessary for the Commission to prescribe other rules regarding membership, such as procedures for admitting new members or time limits on the service of particular entities and individuals? Operating Procedures: Having charge, as it would, of the centerpiece
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-6A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-6A1.pdf
  • Information Technology Advisory Commission Comments on Competition Public Notice at 1 (Sept. 13, 2010). APCO Project 25 Steering Committee Comments on Competition Public Notice at 10-11 (Sept. 20, 2010). See supra Section III.A. See id. See, e.g., 3rd Generation Partnership Project; Technical Specification Group Services and System Aspects; Network Sharing; Architecture and functional description (Release 9), 3GPP TS 23.251 at 4.2.1 (2009). See Public Safety and Homeland Security Bureau Seeks Comment on Interoperability, Out of Band Emissions and Equipment Certification for 700 MHz Public Safety Broadband Networks, PS Docket 06-229, Public Notice, 25 FCC Rcd 5486 (PSHSB 2010) (Technical Public Notice). See NPSTC BBTF Report at 6.3.1. See id. See Technical Public Notice at 5487-88. For example, if there are 55
• http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.doc http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.pdf
  • would be subject to the reporting requirements and process adopted therein were collecting much of the same information that would be required to be reported under Part 4. See 2004 Part 4 Order and NPRM, 19 FCC Rcd at 16912-3 ¶ 166-69; see also 1992 Part 4 Report and Order, 7 FCC Rcd at 2013 ¶17 (1992). 47 C.F.R. § 4.2 provides that ``[r]eports filed under this part will be presumed to be confidential. Public access to reports filed under this part may be sought only pursuant to the procedures set forth in 47 CFR § 0.461.'' See also 2004 Part 4 Report and Order, 19 FCC Rcd at 16856. See 47 C.F.R. § 0.442. See also 47 U.S.C. § 154(i)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-2664A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-2664A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-2664A1.txt
  • Simultaneously Probability P(N) Power Increase: 10log(N) [dB] Net Power Increase Adjusted for Probability of Occurrence: 10log(P(N)) + 10log(N) [dB] 1 0.260 0 -5.85 2 0.049 3.0 -10.09 3 0.006 4.7 -17.52 4 0.001 6.0 -24.00 By summing all the net power increases adjusted for probability of occurrence, we obtain (4) ONPI = 10log[10-5.85/10 + 10-10.09/10 + 10-17.52/10 + 10-24.00/10] ~ -4.2 dB We can draw two relevant observations from Spacenet's proposal. First, we recognize that Spacenet's showing assumes that the described events are taking place randomly under a Poisson distribution and the network traffic is being held to a 38% load, which yields about 26% throughput (or efficiency). Based on these assumptions, we can obtain a set of probabilities of carrier
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-925A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-925A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-925A1.txt
  • Guidelines''). The petitions of Mobile Phone and TeleTouch and the comments of Metrocall address only Applicants' request for a waiver of the narrowband PCS ownership restriction. Public Interest Statement at 11, 19. Paging Network To Miss Interest Payments, Dow Jones News Service, Jan. 27, 2000. The Strategis Group, The State of the U.S. Paging Industry: 1999 (1999), at 31, Table 4.2. Letter from Kathryn A. Zachem, Counsel for Arch Communications Group, Inc., to Magalie Roman Salas, Secretary, Federal Communications Commission, dated February 23, 2000, at Merged Entity Aggregate Channel Analysis pp. 1-15 (``February 23 Ex Parte Letter''). These 14 markets are Buffalo and Albany, NY; Birmingham, AL; Akron, Cincinnati, Cleveland, Columbus, Dayton, and Toledo, OH; Providence, RI; West Palm Beach and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1018A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1018A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1018A1.txt
  • consummated on August 11, 1993 (BALH-921015EB). The OSC also applied to licenses held by Contemporary Media, Inc. for Stations WBOW(AM), WBFX(AM) and WZZQ(FM), all Terre Haute, Indiana; to the license held by Contemporary Broadcassting, Inc. for KFMZ(FM), Columbia, Missouri; and to its construction permit for KAAM-FM, Huntsville, Missouri. Channel 221A was allotted to Dixon with a site restriction 6.8 kilometers (4.2 miles) west of the community. The proposed site for Channel 243A at Dixon is 13.9 kilometers (8.6 miles) northeast of the community. Federal Communications Commission DA 99-1146 Federal Communications Commission DA 99-1146 Federal Communications Commission DA 99-1146 Federal Communications Commission DA 01-1018 Federal Communications Commission DA 99-1146 Federal Communications Commission DA 99-1146 Federal Communications Commission DA 01-1018 „Lÿ „Lÿ „Lÿ
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1247A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1247A1.txt
  • W 0000417958 GRAYS HARBOR MASON CELLULAR LIMITED PARTNERSHIP ABERDEEN 04/04/2001 06805.00000 46-56-44.1 N WA MD WMS352 123-47-49.1 W 0000417958 GRAYS HARBOR MASON CELLULAR LIMITED PARTNERSHIP ABERDEEN 04/04/2001 10551.25000 46-56-44.1 N WA MD WMS352 123-47-49.1 W 0000417958 GRAYS HARBOR MASON CELLULAR LIMITED PARTNERSHIP ABERDEEN 04/04/2001 10602.50000 46-56-44.1 N IL MD WLT387 089-09-51.3 W 0000417966 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 04/04/2001 02161.50000 37-05-04.2 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WLT387 089-09-51.3 W 0000417966 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 04/04/2001 06063.80000 37-05-04.2 N IL MD WLT387 089-09-51.3 W 0000417966 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 04/04/2001 11215.00000 37-05-04.2 N IL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1315A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1315A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1315A1.txt
  • 6. Second Amendment to Satellite Construction and System Definition Contract, ¶4. Third Amendment to Satellite Construction and System Definition Contract, ¶¶ 2.2 and 7. No such authorization was included among the documents MCHI submitted. Program Management Contract for the Construction of the ELLIPSO System (signed July 31, 2000), Exhibit A ¶1.1. Id., Exhibit A ¶1.2. Id., ¶20. Id., ¶6.1. Id., ¶4.2. See Norris Satellite Communications, Inc., 12 FCC Rcd 22,299 (1997), and PanAmSat Licensee Corp., FCC 01-178 (rel. May 25, 2001); cf. CBS, Inc., 99 FCC 2d 565 (1984). There is no evidence that MCHI entered into a non-contingent full-system satellite-construction contract after October 12, 2000, but it is unnecessary for purposes of this order to make any finding in this
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1464A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1464A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1464A1.txt
  • is acceptable under the 2 percent criterion for de minimis impact that is applied in evaluating requests for modification of initial DTV allotments under Section 73.623(c)(2). We propose to substitute DTV Channel 13 for DTV Channel 30 for station KOAM-TV at Pittsburg with the following specifications: State & City DTV Channel DTV power (kW) Antenna HAAT (m) KS Pittsburg 13 4.2 336 4. Accordingly, we seek comments on the proposed amendment of the DTV Table of Allotments, Section 73.622(b) of the Commission's Rules, for the community listed below, to read as follows: Channel No. City Present Proposed Pittsburg, Kansas 30 13 5. The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.txt
  • IX Circuit Equipment - Jointly Used N/A N/A N/A N/A N/A 1339 # Conversation-minutes Factor N/A N/A N/A N/A N/A 1342 Total Category 4.23 Basic IX. Circuit Equip. COE N/A N/A N/A N/A N/A 1350 Category 4.23 Special IX. Circuit Equip. COE N/A N/A N/A N/A N/A 1370 Total Category 4.23 COE IX Circuit Equipment N/A N/A 1380 Total Category 4.2 COE IX. Circuit Equipment N/A N/A 1392 Category 4.3 COE Host/Remote Circuit Equip. - Jointly Used N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers Factor N/A N/A N/A N/A N/A 1394 Total Cat. 4.3 Host/Remote Circuit Equip. COE. N/A 1400 Total Category 4 COE Circuit Equipment N/A 1410 Total COE Investment N/A 1420 Category 1 IOT -
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1704A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1704A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1704A1.txt
  • the Matter of Northern Telecom Inc. Petition of the Signal Power Limitations Contained in Section 68.308(e)(1) of the Commission's Rules, NSD-L-98-135, Order, 14 FCC Rcd 12048 (Com. Car. Bur. Network Services Div. 1999)(Nortel Order). Part 68 Waiver Request of Alameda Engineering, Inc., Order on Reconsideration, NSD-L-98-154, 15 FCC Rcd 1658 (Com. Car. Bur. 1999) (Alameda Recon. Order). ANSI T1.417, clause 4.2, Spectral Compatibility. ANSI standard T1.417 states that a new technology is spectrally compatible if its service: (A) fits within the power spectral density (PSD) mask of one of the nine defined Spectrum Management (SM) Classes, or (B) is demonstrated by a standardized analysis -- ``Method B'' -- to cause interference to basis systems that is less than or equal to
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1722A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1722A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1722A1.txt
  • Rules Branch, Commercial Wireless Division, Wireless Telecommunications Bureau, dated August 21, 2000. Although Instapage did not provide exact figures of its coverage as of the construction deadline, it did indicate that, as of that date, it was only providing coverage to the San Juan, Puerto Rico area. At the most, the greater San Juan, Puerto Rico area only includes approximately 4.2 percent of the population or 5,097 square kilometers of Region 2, significantly less than the minimal 37.5 percent population coverage or 150,000 square kilometers geographic coverage requirement of regional narrowband PCS licensees. This estimate was calculated using the population and square kilometers of the Basic Trading Area of San Juan, Puerto Rico (BTA488), which is one component of Region 2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1905A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1905A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1905A1.txt
  • all base-to-base/mobile operations are provided under Section 90.35(c)(64). Lemont Petition As noted above, on January 31, 2001, the Branch granted D&I a license under Call Sign WPRU305, which authorizes D&I to operate an operational fixed (FXO) station on frequency 465.9875 MHz at the Lemont Oakwood School in Lemont, Illinois. The Commission's licensing records reflect that Station WPRU305 is located approximately 4.2 km (2.6 mi) from the site of Lemont's mobile relay for Station WPFS667. On February 26, 2001, Lemont filed a petition for reconsideration against this grant. However, the record reflects that Lemont failed to serve its Petition on D&I as required under Section 1.106(f) of the Commission's Rules. Accordingly, we find the Lemont Petition to be procedurally defective and we
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2081A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2081A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2081A1.txt
  • 94-42-23 W. In addition, we find that this channel is acceptable under the 2 percent criterion for de minimis impact that is applied in evaluating requests for modification of initial DTV allotments under Section 73.623(c)(2) for Station KOAM-TV with the following specifications: DTV DTV power Antenna DTV Service State & City Channel (kW) HAAT (m) Pop. (thous.) KS Pittsburg 13 4.2 336 357 3. Accordingly, pursuant to the authority contained in Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b) of the Communications Act of 1934, as amended, and Sections 0.61, 0.204(b) and 0.283 of the Commission's Rules, IT IS ORDERED, That effective October 22, 2001, the DTV Table of Allotments, Section 73.622(b) of the Commission's Rules, IS AMENDED, with respect to
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2146A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2146A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2146A1.txt
  • Contact: Sharon P. McDonald, (202) 418-2180. D. MM Docket No. 01-239; RM-10245 Petitioner: Jeraldine Anderson 1702 Cypress Drive Irving, Texas 75061 Proposal: Allot Channel 293A at Bruni, Texas, as the community's first local aural transmission service. Community Present Proposed Bruni, Texas --- 293A Coordinates: 27-29-12 NL and 98-51-00 WL Additional Information: This allotment requires a site restriction of 6.8 kilometers (4.2 miles) north to avoid a short-spacing to the licensed site of Station KPSO-FM, Channel 292A, Falfurria, Texas, the construction permit site of Station KTKY(FM), Channel 293C2, Taft, Texas, and the allotment site for Channel 294A at El Lobo, Texas. Since Bruni is located within 320 kilometers (199 miles) of the U.S.-Mexican border, concurrence of the Mexican government has been requested.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2156A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2156A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2156A1.txt
  • allotment of Channel 288A to Freer, Texas, since it could provide a second local, and first competitive FM transmission service at that community. A staff engineering analysis has determined that Channel 288A can be allotted to Freer consistent with the minimum distance separation requirements of Section 73.207(b)(1) of the Commission's Rules provided the transmitter is located at least 6.8 kilometers (4.2 miles) south of the community, utilizing coordinates 27-49-20 NL and 98-38-04 WL. Additionally, as Freer is located within 320 kilometers (199 miles) of the U.S.-Mexico border, concurrence of the Mexican government to the proposed allotment of Channel 288A at that community will be required. 3. Accordingly, we seek comments on the proposed amendment to the FM Table of Allotments, Section
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2209A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2209A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2209A1.txt
  • local government, post office, city hall, and numerous churches and that the allotment of Channel 284A will provide an outlet for local self-expression to the residents of Asherton. A staff engineering analysis indicates that Channel 284A can be allotted to Asherton consistent with the minimum distance separation requirements of the Commission's Rules provided there is a site restriction 6.8 kilometers (4.2 miles) south of the community. The site restriction will prevent a conflict with Station KVOU-FM, Channel 285C3, Uvalde, Texas. Since Asherton is located within 320 kilometers of the U.S.-Mexican border, concurrence of the Mexican Government will be requested for the allotment of Channel 284A at Asherton. 3. In view of the fact that the proposed allotment could provide a first
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2379A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2379A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2379A1.txt
  • of 1000 people. Crawford also states that Rosecommon has its own local government with a village manager, post office and volunteer fire department, townhall and a number of local churches. A staff engineering analysis indicates that Channel 246A can be allotted to Rosecommon consistent with the minimum distance separation requirements of the Commission's Rules provided there is a site restriction 4.2 kilometers (2.6 miles) northwest of the community. The site restriction will prevent a conflict with Station WWCM, Channel 245A, Standish, Michigan. Since Rosecommon is located within 320 kilometers of the U.S.-Canadian border, concurrence of the Canadian Government will be requested for the allotment of Channel 246A at Rosecommon. 3. In view of the fact that the proposed allotment could provide
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2445A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2445A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2445A1.txt
  • Contact: R. Barthen Gorman (202) 418-2180 B. MM Docket No. 01-305; RM-10310 Petitioner: Jeraldine Anderson 1702 Cypress Drive Irving, Texas 75061 Proposal: Allot Channel 247A at San Isidro, Texas, as that community's first local aural transmission service. Community Present Proposed San Isidro, Texas --------- 247A Coordinates: 26-45-00 NL and 98-26-00 WL Additional Information: This allotment requires a site restriction of 4.2 kilometers (2.6 miles) northeast of San Isidro. San Isidro is not listed in the 1990 U.S. Census, although the 2001 Rand McNally Commercial Atlas & Marketing Guide (``Rand McNally'') lists the population of San Isidro as consisting of 500 persons. Since Rand McNally does not list San Isidro as being an incorporated community and the 1990 U.S. Census does not
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.txt
  • within the United States to grant, deny, modify or revoke MSV's access to Classified and Sensitive Information under that agency's jurisdiction. ARTICLE IV AUDITING, REPORTING AND NOTICE 4.1 Notice of Obligations: MSV shall instruct appropriate officials, employees, contractors and agents as to their obligations under this Agreement and Implementation Plan (including the reporting requirements under Section(s) 3.3, 3.4, 3.5, 3.6, 4.2, 4.3, 4.4, 4.5, 4.9, and 4.10 of this Agreement) and issue periodic reminders to them of such obligations. 4.2 Reporting of Incidents: MSV shall take all practicable steps to ensure that, if any MSV official, employee, contractor or agent acquires any information that reasonably indicates: (i) a breach of this Agreement or the Implementation Plan; (ii) Electronic Surveillance conducted in
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2764A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2764A1.txt
  • allocation to Region 2 in this band. 15 Appendix S5 ANNEX 1 USA/ /6 MOD TABLE S5-2 NOTE 4 Exceptions for the band 1 492-1 525 MHz are as follows: 4.1 For the land mobile service on the territory of Japan (No. S5.348A): 150 dB(W/m2) in 4 kHz at all angles of arrival is applicable to all satellite space-to-Earth emissions. 4.2 For the aeronautical mobile service for telemetry (No. S5.343), the requirement for coordination is determined by frequency overlap (No. S5.348). Reasons: Consequential changes due to the deletion of the MSS service from the band 1 492- 1 525 MHz. - FCC - Frequency band (MHz) Terrestrial service to be protected Coordination threshold values GSO space stations Non-GSO space stations pfd
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.txt
  • 36.126(e)(4).'' Row 1370 - The definition of this row is revised to read: ``Total Category 4.23 Interexchange Circuit Equipment, total of Rows 1342 and 1350, including Category 4.23 COE that is directly assigned pursuant to Section 69.306(e) and the Part 69 Reconsideration Order, at paragraph 48.'' Row 1380 - The definition of this row is revised to read: ``Total Category 4.2 Interexchange Circuit Equipment, total of Rows 1310, 1324, and 1370.'' Row 1392 - The definition of this row is revised to read: ``Category 4.3 Host/Remote Message Circuit Equipment that is jointly used and is allocated pursuant to Sections 36.126(f)(2) and 36.157(b).'' Row 1393 - The definition of this row is revised to read: ``Minutes-of-use-kilometers used to allocate Category 4.3 Host/Remote
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.txt
  • each terminal shall be capable of inhibiting its own transmission in the event it detects unintended satellite tracking; 3) AMSS mobile terminals are monitored and controlled by a ground-based Network Control and Monitoring Center (``NCMC'') or equivalent facility; 4) each AMSS mobile terminal shall: 4.1.) be able to receive at least ``enable transmission'' and ``disable transmission'' commands from the NCMC; 4.2.) cease transmissions after receiving any ``parameter change'' command, which may cause harmful interference to other satellite systems during the change, until it receives an ``enable transmission'' command from its NCMC; and 4.3.) be monitored by the NCMC to determine if its operation is malfunctioning; and 4.4.) self-monitor, and shall automatically cease transmission in the event of an operation fault which
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.txt
  • 200 27 161 10 161 -10 161 Response Station 6000 CDMA 1250 27 161 10 161 -10 161 6000 CDMA 3750 27 161 10 161 -10 114 6000 W-CDMA 5000 27 161 10 161 -10 100 6000 TDMA 30 27 161 10 161 -10 161 6000 TDMA 200 27 161 10 161 -10 161 Similar to the analysis above, Table 4.2 tabulates the minimum spacing required to prevent interference between 3G base and mobile stations and first adjacent ITFS/MDS main and response station receivers. Table 4.2: Calculation of Adjacent Channel Separation Distances of 3G Stations to ITFS/MDS Stations ITFS/MDS System Parameters 3G System Parameters 3G Base Station (500 Watts) 3G Base Station (10 Watts) 3G Mobile Station (100 milliwatts) Protected Receiver
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.txt
  • 200 27 161 10 161 -10 161 Response Station 6000 CDMA 1250 27 161 10 161 -10 161 6000 CDMA 3750 27 161 10 161 -10 114 6000 W-CDMA 5000 27 161 10 161 -10 100 6000 TDMA 30 27 161 10 161 -10 161 6000 TDMA 200 27 161 10 161 -10 161 Similar to the analysis above, Table 4.2 tabulates the minimum spacing required to prevent interference between 3G base and mobile stations and first adjacent ITFS/MDS main and response station receivers. Table 4.2: Calculation of Adjacent Channel Separation Distances of 3G Stations to ITFS/MDS Stations ITFS/MDS System Parameters 3G System Parameters 3G Base Station (500 Watts) 3G Base Station (10 Watts) 3G Mobile Station (100 milliwatts) Protected Receiver
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-101A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-101A1.txt
  • - 1525 MHz in Region 2. USA/ /6 MOD Appendix S5 ANNEX 1 TABLE S5-2 NOTE 4 ­ Exceptions for the band 1 492-1 525 MHz are as follows: 4.1 For the land mobile service on the territory of Japan (No. S5.348A): ­ 150 dB(W/m2) in 4 kHz at all angles of arrival is applicable to all satellite space-to-Earth emissions. 4.2 For the aeronautical mobile service for telemetry (No. S5.343), the requirement for coordination is determined by frequency overlap (No. S5.348). NOCNOTE 5 Reason: Consequential changes due to the deletion of MSS from the band 1 492- 1 525 MHz. Frequency band (MHz) Terrestrial service to be protected Coordination threshold values GSO space stations Non-GSO space stations pfd (per space station)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1246A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1246A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1246A1.txt
  • MB Docket No. 02-126; RM-10448 Petitioner: David P. Garland 1110 Hackney Street Houston, Texas 77023 Proposal: Allot Channel 266A at Wynnewood, Oklahoma as the community's second FM broadcast service. Community Present Proposed Wynnewood, Oklahoma 283A 266A, 283A Coordinates: 34-38-23 NL and 97-05-38 WL Additional Information: The proposed allotment of Channel 266A at Wynnewood requires a site restriction of 6.7 km (4.2 miles) east of Wynnewood at the reference coordinates indicated above. Petitioner states that Wynnewood is an incorporated city with a population of nearly 3,000 persons. FCC Contact: Deborah A. Dupont (202) 418-7072 H. MB Docket No. 02-127; RM-10449 Petitioner: William J. Edwards 706 Main Roundup, Montana 59072 Proposal: Allot Channel 248A at Roundup, Montana as the community's first aural broadcast
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.txt
  • and regulatory directives, including the following: Determine when to initiate NPA Relief by continually monitoring CO Code growth and projecting exhaust Upon the identification of a potential exhaust situation, notify appropriate regulatory authorities and affected parties within the NPA If necessary, immediately organize a relief-planning meeting to obtain local industry consensus and subsequent regulatory direction for a relief implementation plan. 4.2.6 Management of Jeopardy Conditions NANPA shall: Declare a jeopardy NPA condition within any NPA that meets the conditions established in the appropriate industry guidelines and regulatory orders Monitor CO Code growth and projected exhaust Notify appropriate regulatory authorities and affected parties within the NPA Notify the industry that jeopardy code rationing is available if so desired, or in the absence
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1543A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1543A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1543A1.txt
  • in providing an additional local aural transmission service to Freer, Texas, we will allot Channel 288A to that community, as requested. 3. As stated in the Notice, Channel 288A can be allotted to Freer, in conformity with the minimum distance separation requirements of Section 73.207(b)(1) of the Commission's Rules provided the transmitter site therefor is located at least 6.8 kilometers (4.2 miles) south of the community, utilizing reference coordinates 27-49-20 NL and 98-38-04 WL. Additionally, as Freer is located within 320 kilometers (199 miles) of the U.S.-Mexico border, concurrence of the Mexican government to the proposed allotment of Channel 288A at that community has been requested, but not yet received. Rather than delay the opportunity to file an application for this
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1553A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1553A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1553A1.txt
  • Contact: Sharon P. McDonald (202) 418-2180 L. MB Docket No. 02-169; RM-10481 Petitioner: Charles Crawford 4553 Bordeaux Ave. Dallas, Texas 75205 Proposal: Allot Channel 284A at Escobares, Texas, as the community's first local aural transmission service. Community Present Proposed Escobares, Texas --- 284A Coordinates: 26-26-29 NL and 98-54-14 WL Additional Information: This allotment requires s site restriction of 6.8 miles (4.2 miles) northeast to avoid a short-spacing to the licensed site of Station XHMF-FM, Channel 283C, Monterrey, Mexico. Since Escabares is located within 320 kilometers (199 miles) of the U.S.-Mexico border, concurrence of the Mexican government has been requested. FCC Contact: Sharon P. McDonald (202) 418-2180 M. MB Docket No. 02-170; RM-10482 Petitioner: Linda Crawford 3500 Maple Ave., #1320 Dallas, Texas
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1589A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1589A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1589A2.txt
  • 48 trading periods conducted under the CAP MFN treatments. Result 3: The MFN sessions generate similar efficiency levels to the No MFN sessions in the more concentrated treatments, and lower efficiency levels in the low concentrated treatment. The absence of sufficient data made it impossible to perform the standard statistical test to determine if the observed difference was statistically significant. 4.2 Buyer's Bargaining Power An important policy issue is whether a buyer's bargaining power increases with an increase in the buyer's size, where size is measured by the share of the MVPD market served. A trade between a cable operator and a cable network creates an economic surplus. This surplus is composed of the amount of money the cable operator is
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1589A5.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1589A5.txt
  • 6020318OG 7 6 3 478 203 216 1200 3 6020318OG 7 7 3 600 237 161 1400 3 6020318OG 7 8 3 913 372 88 2200 24 6020318OG 7 9 3 627 195 329 1400 65 6020318OG 7 8 4 1427 1450 264 2200 4 6020318OG 8 8 1 203 35 0.22 2200 1 6020318OG 8 9 1 143 15 4.2 1400 1 6020318OG 8 5 2 204 26 2 2000 131 6020318OG 8 6 2 112 16 4.8 1200 2 6020318OG 8 7 2 126 18 14 1400 112 6020318OG 8 5 3 745 339 460 2000 81 6020318OG 8 6 3 478 203 222 1200 3 6020318OG 8 7 3 600 237 182 1400 3 6020318OG 8 8 3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1728A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1728A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1728A1.txt
  • Commission in response to the Notice. 2. We believe that the public interest would be served by the allotment of Channel 284A at Asherton, Texas, as it will provide the community with an its first local FM service. Channel 284A can be allotted to Asherton in compliance with the Commission's minimum distance separation requirements with a site restriction 6.8 kilometers (4.2 miles) south of the community. Although Mexican concurrence has been requested for the allotment of Channel 284A at Asherton, notification has not been received. Therefore, operation with the facilities specified for Asherton herein is subject to modification, suspension, or termination without right to hearing, if found by the Commission to be necessary in order to conform to the 1992 USA-Mexico
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1876A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1876A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1876A1.txt
  • Docket No. 01-239, RM-10245; 16 FCC Rcd 16470 (2001) Action: At the request of Jeraldine Anderson, we are allotting Channel 293A at Bruni, Texas, as the community's first local aural transmission service. Coordinates: The reference coordinates for Channel 293A at Bruni are 27-29-12 North Latitude and 98-51-00 West Longitude. Additional Information: This allotment requires a site restriction of 6.8 kilometers (4.2 miles) north to avoid a short-spacing to the licensed site of Station KPSO-FM, Channel 292A, Falfurrias, Texas, the construction permit site of Station KTKY(FM), Channel 293C2, Taft, Texas, and the allotment site for Channel 294A at El Lobo, Mexico. Although concurrence has been requested for Channel 293A at Bruni, notification has not been received. If a construction permit is granted
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2101A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2101A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2101A1.txt
  • F. Smith (202) 418-2180 H. MB Docket No. 02-265; RM-10556 Petitioner: Maurice Salsa 5615 Evergreen Valley Drive Kingwood, Texas 77345 Proposal: Allot Channel 272A at Westbrook, Texas, as that community's first local aural transmission service. Community Present Proposed Westbrook, Texas --------- 272A Coordinates: 32-22-24 NL and 101-04-58 WL Additional Information: This allotment requires a site restriction of 6.8 kilometers ( 4.2 miles) west to avoid a short-spacing to the license site of Station KFZX, Channel 271C, Gardendale, Texas. Since Westbrook is located within 320 kilometers (199 miles) of the U.S.-Mexican border, Mexican concurrence has been requested. FCC Contact: Rolanda F. Smith (202) 418-2180 3. Comments, reply comments, counterproposals and other pleadings filed in response to this multiple docket Notice of Proposed
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.txt
  • in the band 12.5-12.7 GHz With respect to § 4.1.1 c) of Article 4, an administration in Region 2 shall be considered as being affected if the proposed new or modified assignment in the Regions 1 and 3 List would result in exceeding the power flux-densities given below, at any test point in the service area affected. spect to § 4.2.3 a), 4.2.3 b) or 4.2.3 f) of Article 4, as appropriate, an administration in Region 1 or 3 shall be considered as being affected if the proposed modification to the Region 2 Plan would result in exceeding the power flux-densities given below, at any test point in the service area affected: llite space station in Region 1 or 3 and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2458A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2458A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2458A1.txt
  • service area or provide coverage to a composite area of 150,000 square kilometers.'' Although Instapage did not provide exact figures of its coverage as of the construction deadline, it did indicate that, as of that date, it was providing coverage only to the San Juan, Puerto Rico area. At most, the greater San Juan, Puerto Rico area only includes approximately 4.2 percent of the population or 5,097 square kilometers of Region 2. On July 20, 2001, the Division dismissed Instapage's construction notification as defective and denied its request for waiver. The Division found that Instapage's construction notification was untimely filed and that, by its own admission, Instapage had failed to satisfy the minimum five-year coverage benchmarks in effect for narrowband PCS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2512A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2512A2.txt
  • the General Counsel of X0, the General Counsel of the FBI, and the Deputy Attorney General, Criminal Division, DOJ, or their designees, unless the FBI or the DOJ believes that important national interests can be protected, or a Domestic Communications Company believes that its paramount commercial interests can be resolved, only by resorting to the measures set forth in Section 4.2 of this Agreement.If, after meeting with higher authorized officials, any of the Parties determines that further negotiation would be fruitless, then that Party may resort to the remedies set forth in Section 4.2 of this Agreement.If resolution of a disagreement requires access to Classified Information, the Parties shall designate a person or persons possessing the appropriate security clearances for the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3067A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3067A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3067A1.txt
  • 418-2180 E. MB Docket No. 02-265; RM-10556 Action: At the request of Maurice Salsa, we are allotting Channel 272A at Westbrook, Texas, as the community's first local FM transmission service. Coordinates: The reference coordinates for Channel 272A at Westbrook, Texas are 32-22-24 North Latitude and 101-04-58 West Longitude. Additional Information: This allotment requires a site restriction of 6.8 kilometers ( 4.2 miles) west to avoid a short-spacing to the license site of Station KFZX, Channel 271C, Gardendale, Texas. Although concurrence has been requested for Channel 272A at Westbrook, Texas, notification has not been received. If a construction permit is granted prior to the receipt of formal concurrence in the allotment by the Mexican government, the construction permit will include the following
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3213A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3213A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3213A1.txt
  • Gorman (202) 418-2180 G. MM Docket No. 01-305; RM-10310 Action: At the request of Jeraldine Anderson, we are allotting Channel 247A to San Isidro, Texas, as that community's first local aural transmission service. Coordinates: The reference coordinates for Channel 247A at San Isidro are 26-45-00 North Latitude and 98-26-00 West Longitude. . Additional Information: This allotment requires a site restriction 4.2 kilometers (2.6 miles) northeast of San Isidro. Since the allotment is within 320 kilometers (199 miles) of the U.S.-Mexico border, clearance for the allotment was sought with the Mexican Government. The Mexican Government has granted its clearance of this allotment. Sound Investments Unlimited, Inc., the licensee of FM Station KCTM, Rio Grande City, Texas, filed comments asserting that San Isidro
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.txt
  • 159 when filing an electronic application through IBFS. Instructions for doing so follow. On the IBFS Application Menu Screen page, press the Form 159 Menu button. See Exhibit 4.1 below. Exhibit 4.1 TIN, if other than Applicant, and check the box(es) next to the left of the application(s) for which payment is to be made. Press the Continue button. Exhibit 4.2 The IB customer will be presented with the Electronic Form 159 screen shown in Exhibit 4.3. Insert the Payor's FRN and password and press the Continue button. Exhibit 4.3 The Payment Summary page displays. Press the View 159 button. Please note on Exhibit 4.4 that the Payor's FRN and TIN are automatically inserted into boxes 11 and 12, respectively. The
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1185A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1185A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1185A1.txt
  • Plan is necessary. We have therefore taken steps to request such modification. Based upon the results of the technical and interference analysis, we have sufficient evidence to determine that Rainbow 1 will not cause unacceptable interference to other U.S. DBS systems. We need to seek the agreement of Canada and Mexico and of France for certain EUTELSAT networks, under Section 4.2 of Appendix 30 because the limits of Section 2 of Annex 1 of Appendix 30 are exceeded. Accordingly, we have forwarded R/L DBS's technical analysis to the ITU for its review. We find that, subject to the ITU review and agreement process with other administrations, granting R/L DBS's request to modify its DBS construction permit to incorporate spot beam technology
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1538A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1538A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1538A1.txt
  • Dupont, (202) 418-7072. B. MB Docket No. 03-30; RM-10644 Action: At the request of Dana J. Puopolo, we are allotting Channel 255A at Trona, California, as the community's first local aural transmission service. Coordinates: The reference coordinates for Channel 255A at Trona are 35-43-51 NL and 117-18-28 West Longitude. Additional Information: This allotment requires a site restriction of 6.8 km (4.2 miles) southeast of Trona at the coordinates indicated above. FCC Contact: Deborah A. Dupont, (202) 418-7072. C. MB Docket No. 03-29; RM-10643 Action: At the request of David P. Garland, we are allotting Channel 286A at Muldrow, Oklahoma, as the community's first local aural transmission service. Coordinates: The reference coordinates for Channel 286A at Muldrow are 35-29-47 NL and 94-36-04
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1708A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1708A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1708A1.txt
  • chamber of commerce, and public schools. In addition, Petitioner represents that there are numerous organizations and businesses located in Lake City, many of which incorporate ``Lake City'' in their names. 3. The proposed reference coordinates for Channel 244A at Lake City, Tennessee, are 36-12-08 North Latitude and 84-13-36 West Longitude. The allotment will require a site restriction of 6.7 km (4.2 miles) west of Lake City. The site restriction is necessary to protect Station WXJB-FM, Channel 243A, Harrogate, Tennessee, and Station WDOD-FM, Channel 243C0, Chattanooga, Tennessee. Channel 244A at Lake City will serve 136,729 persons from the proposed location. 4. This proposal warrants consideration because it complies with our technical requirements and would serve the public interest. We therefore shall commence
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.txt
  • of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If a license experiences a transfer of control or assignment of authorization, the authorized use of the Cellular SID
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2104A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2104A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2104A1.txt
  • No. 03-155; RM-10735 Petitioner: Dana J. Puopolo 2134 Oak Street, Unit C Santa Monica, California 90405 Proposal: Allot Channel 261A at Montauk, New York, as that community's third local aural transmission service. Community Present Proposed Montauk, New York 235A, 284A 235A, 261A, 284A Coordinates: 41-03-13 NL and 71-52-43 WL Additional Information: This allotment requires a site restriction of 6.7 kilometers (4.2 miles) east to avoid a short-spacing to the license site of Station WEZN-FM, Channel 260B, Bridgeport, Connecticut. FCC Contact: Rolanda F. Smith (202) 418-2180 3. Comments, reply comments, counterproposals and other pleadings filed in response to this multiple docket Notice of Proposed Rule Making should reference only the specific docket to which the filing pertains. The Commission's authority to institute
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2613A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2613A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2613A1.txt
  • 46; Complaint, Exhibit 8 (Bagley Declaration) at 2, ¶ 8. Implementation of the Local Competition Provisions in the Telecommunications Act of 1996, CC Docket No. 96-98, Interconnection Between Local Exchange Carriers and Commercial Mobile Radio Service Providers, CC Docket No. 95-185, Order on Reconsideration, 14 FCC Rcd 18049, 18086, ¶ 107 (1999) (emphasis added). Complaint, Exhibit 6 (New Contract), § 4.2. Complaint at 12, ¶ 54-55. See also Reply at 36-37. Response at 18 & Exhibit F (Declaration of Obie Youngblood [``Youngblood Declaration'']) at 2, ¶ 9; Exhibit G (Declaration of Ron Marshall [``Marshall Declaration'']) at 2, ¶ 5; Exhibit K Davis Declaration at 4-5, ¶¶ 16-18. Neither the Response nor the declarations accuse the Cable Operators specifically of making unauthorized
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.txt
  • Docket No. 02-169; RM-10481; 17 FCC Rcd 12824 (2002) Action: At the request of Charles Crawford, we are allotting Channel 284A at Escobares, Texas, as the community's first local aural transmission service. Coordinates: The reference coordinates for Channel 284A at Escobares are 26-26-29 North Latitude and 98-54-14 West Longitude. Additional Information: This allotment requires a site restriction of 6.8 kilometers (4.2 miles) northeast to avoid a short-spacing to the licensed site of Station XHMF-FM, Channel 283C, Monterrey, Mexico. Although Mexican concurrence has been requested for Channel 284A at Escobares, notification has not been received. If a construction permit is granted prior to the receipt of formal concurrence in the allotment by the Mexican government, the construction permit will include the following
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-273A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-273A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-273A1.txt
  • MB Docket No. 03-30; RM-10644 Petitioner: Dana J. Puopolo 2134 Oak St., Unit C Santa Monica, California 90405 Proposal: Allot Channel 255A at Trona, California as the community's first local service. Community Present Proposed Trona, California -- 255A Coordinates: 35-43-51 NL and 117-18-28 WL Additional Information: Channel 255A can be allotted to Trona with a site restriction of 6.8 km (4.2 miles) southeast of Trona at the reference coordinates indicated above. Petitioner states that Trona is an incorporated town with a population of 3,558 persons, although the 2000 United States Census Statistics do not list Trona as a city, town, or census designated place. Accordingly, petitioner must submit sufficient information to establish that Trona qualifies as a community for FM allotment
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2982A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2982A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2982A1.txt
  • Petitioner asserted in its comments that the names Fortuna and Fortuna Foothills are interchangeably used. See Low Power Television Service, 51 RR 2d 476 (1982) The city reference coordinates for Fortuna, AZ are 32-41-26 NL and 114-27-8 WL, whereas the city reference coordinates for Fortuna Foothills, AZ are 32-39-28 NL and 114-24-40 WL. Thus, the two areas are at least 4.2 kilometers (2.8 miles) apart. See Gretna, Marianna, Quincy and Tallahassee, Florida, 6 FCC Rcd 633 (M.M. Bur 1991). See Semora, North Carolina, 5 FCC Rcd 934 (1990). (...continued from previous page) (continued....) Federal Communications Commission DA 03-2982 Federal Communications Commission DA 03-2982 @ _ n ƒ ˆ F TˆÓ� „ ^„ „ ^„ ­
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.txt
  • 310(b)(3) is inapplicable to the Applications). We note that the New GX/Executive Branch Agreement provides first for informal resolution of any disputes. See New GX/Executive Branch Agreement at Art. 4.1. If any of the parties to the New GX/Executive Branch Agreement determines that further negotiation would be fruitless, Article 4.1 authorizes the party to resort to the remedies of Article 4.2 to enforce the New GX/Executive Branch Agreement. See id. Article 4.2 includes the right of a party to bring action for appropriate judicial relief and expressly does not limit the right of a U.S. government agency, inter alia, to request the Commission to modify, condition, revoke, cancel or render null and void any license, permit, or other authorization granted or
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A3.txt
  • or DHS believes that important national interests can be protected, or a Domestic Communications Company believes that its paramount commercial interests can be resolved, only by resorting to the measures set forth in Sectlon2oT3iiiie--if, after meeting wikim'=iaiais, any of the Parties determines that Mer negotiation would be fruitless, then that Party may resort to the remedies set forth in Section 4.2 of this Agreement. If resolution of a disagreement requires access to Classified Information, the Parties shall designate a person or persons possessing the appropriate security clearances for the purpose of resolving that disagreement. Informal Resolution -- 4.2. Enforcement of Aaeement. Subject to Section 4.1 of this Agreement, if any of the Parties believes that any other of the Parties has
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.txt
  • Lafayette MSA Limited Partnership among Lafayette CGSA, Inc. and Century Telephone Enterprises, Inc. (Mar. 8, 1990) (``Limited Partnership Agreement''). The Limited Partnership Agreement is attached to the Petition as an exhibit. See id. §§ 4.1, 7.2; see also Petition at 7-8. The Limited Partnership Agreement does provide the limited partner with passive investor protections. See Limited Partnership Agreement, at § 4.2. These provisions, however, would not confer control of Lafayette to ALLTEL. is usually the output-based market share of carrier i, and n is the number of carriers in the market. The HHI can range from nearly zero in the case of an atomistic market of 10,000 in the case of pure monopoly. Because the HHI is based on the squares
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.txt
  • need not lease duplicate facilities because it has the option, under section 4.1.1 of the proposed Agreement, to ``connect[] to all of Verizon's tandems through a single point in the LATA,'' Cavalier claims that Verizon never before has offered Cavalier the option of not directly connecting at the new tandem. Cavalier complains that Verizon's proposed section 4.1.1, and accompanying schedule 4.2.7, which itemizes end office interconnection arrangements between the Parties in Virginia, are at best vague, and, at worst, inconsistent with Verizon's argument about tandem rehomings. Schedule 4.2.7, which specifies only three points of interconnection (POIs) between Cavalier and Verizon, does not explicitly recognize that Cavalier exchanges a significant amount of traffic through end offices, not tandems. Cavalier fears that, under
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-4120A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-4120A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-4120A1.txt
  • Island, as the community's fourth local FM transmission service. To accommodate the allotments, we are also substituting Channel 293B for Channel 258B at Christiansted, Virgin Islands, and modify Station WVIQ-FM's license accordingly. An engineering analysis has determined that Channel 257A can be allotted to Charlotte Amalie in compliance with the Commission's minimum distance separation requirements with a site restriction of 4.2 kilometers (2.6 miles) west to avoid a short-spacing to the allotment site for Channel 258A at Frederiksted, Virgin Islands; and Channel 258A can be allotted to Frederiksted in compliance with the Commission's minimum distance separation requirements at city reference coordinates. To accommodate the allotments, Channel 293B can be substituted at Christiansted in compliance with the Commission's minimum distance separation requirements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.txt
  • of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If a license experiences a transfer of control or assignment of authorization, the authorized use of the Cellular SID
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1_Erratum.doc
  • of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If a license experiences a transfer of control or assignment of authorization, the authorized use of the Cellular SID
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1420A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1420A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1420A1.txt
  • areas designated for rural use, such as the site it specified in its proposal. The allotment of Channel 282C3 at Keeseville has been accepted as Channel 282B1 by Canada. It is a specially negotiated short-spaced allotment limited to 21.3 kW ERP and 100m HAAT or the equivalent along the 16.9° azimuth towards Channel 282C1* in Trios-Rivieres, Quebec, and limited to 4.2 kW ERP and 100 m HAAT or the equivalent along the 337°azimuth to protect Channel 281C* in St. Jean, Quebec, and limited to 6.3 kW ERP and 100 m HAAT or the equivalent along the 329° azimuth to protect Channel 283B* in Cornwall, Ontario. See, e.g., Ozona and Iraan, Texas, 18 FCC Rcd 444 (MB 2003); and Reliance, Georgia, 17
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2461A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2461A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2461A1.txt
  • Contact: Rolanda F. Smith (202) 418-2180 C. MB Docket No. 04-302; RM-11020 Petitioner: Charles Crawford 4553 Bordeaux Ave. Dallas, Texas 75205 Proposal: Allot Channel 271C3 at Lockney, Texas as that community's first local aural transmission service. Community Present Proposed Lockney, Texas ---------- 271C3 Coordinates: 34-05-00 NL and 101-23-15 WL Additional Information: This allotment requires a site restriction of 6.7 kilometers (4.2 miles) southeast to avoid short-spacing to the vacant allotment site of Channel 269A at Turkey, TX and the license sites of FM Station KATP, Channel 270C1, Amarillo, Texas and Station KZII-FM, Channel 273C1, Clovis, New Mexico. FCC Contact: Rolanda F. Smith (202) 418-2180 D. MB Docket No. 04-303; RM-11025 Petitioner: Charles Crawford 4553 Bordeaux Ave. Dallas, Texas 75205 Proposal: Allot
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.txt
  • at 23919, ¶ 62. See VAI/Executive Branch Agreement at Art. 7.1. We note that the VAI/Executive Branch Agreement provides first for informal resolution of any dispute. See VAI/Executive Branch Agreement at Art. 4.1. If any of the parties to the agreement should determine that further negotiation is fruitless, Article 4.1 authorizes the party to resort to the remedies of Article 4.2 to enforce the agreement. See id. Article 4.2 includes the right of a party to bring action for appropriate judicial relief and expressly does not limit the right of a U.S. government agency, among other things, to request the Commission to modify, condition, revoke, cancel or render null and void any license, permit, or other authorization granted or given by
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.txt
  • General Counsel of the FBI, the Deputy Attorney General of the DOJ, and the General Counsel of the DHS or their respective designees, unless the FBI, the DOJ or the DHS believes that important national interests can be protected, or VSNL America believes that paramount commercial interests can be resolved, only by resorting to the measures set forth in Section 4.2. If, after meeting with higher authorized officials, any of the Parties determines that further negotiation would be fruitless, then that Party may resort to the remedies set forth in Section 4.2. If resolution of a disagreement requires access to Classified Information, the Parties shall designate a person or persons possessing the appropriate security clearances for the purpose of resolving that
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-284A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-284A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-284A1.txt
  • comments. Cox Radio, Inc. and CXR Holdings, Inc. (collectively ``Cox Radio''), filed joint opposing comments and supplemental comments. Petitioner filed reply comments and supplemental comments. There were no counterproposals or additional comments received in response to this proceeding. 2. As stated in the Notice, the proposed allotment of Channel 261A to Montauk, New York requires a site restriction 6.7 kilometers (4.2 miles) east to avoid a short-spacing to the license site of Station WEZN-FM, Channel 260B, Bridgeport, Connecticut. Generally, at the allotment stage we only require a petitioner to show that a theoretical reference site exists from which a station can be operated in compliance with the Commission's rules. The reference site is presumed to be available and technically feasible but
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3203A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3203A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3203A2.txt
  • 974549.0 KS HUTCHINSON KSCC 77063 36 3500. 733 375623.0 35 1000. 310 375623.0 712376 22737.6 973042.0 973042.0 KS LAKIN KSWK 60683 3 100. 171 374938.0 8 100. 149 374940.0 114269 23538.7 1010635.0 1010635.0 KS LAWRENCE KMCI 42636 38 5000. 326 385842.0 36 500. 291 385842.0 1961913 18708.6 9432 1.0 9432 1.0 KS PITTSBURG KOAM-TV 58552 7 316. 332 371315.0 13 4.2 340 371315.0 391988 19908.4 944225.0 944225.0 KS SALINA KAAS-TV 11912 18 617. 317 390616.0 17 65. 314 390616.0 202136 15702.1 972315.0 972315.0 KS TOPEKA KTKA-TV 49397 49 2690. 453 390134.0 48 25. 447 390134.0 428773 16002.7 9555 1.0 9555 1.0 KS TOPEKA WIBW-TV 63160 13 316. 421 390019.0 44 892.3 421 390019.0 676754 33475.0 960258.0 960258.0 KS TOPEKA KSNT 67335
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A2.txt
  • 316. 00463 0380340.0 19 544. 463.0 380340 795162 32768.6 823653 37021.2 00974549.0 974549 KS LAKIN KSWK 60683 03 100. 00171 0374938.0 08 35. 00149 0374940.0 101750 21283.9 77510 19809.7 01010635.0 01010635.0 KS LAWRENCE KMCI 42636 38 5000. 00326 0385842.0 36 500. 00291 0385842.0 1958054 20269.4 1963278 18844.4 009432 1.0 009432 1.0 KS PITTSBURG KOAM-TV 58552 07 316. 00332 0371315.0 13 4.2 00340 0371315.0 518617 26827.3 392129 19928.4 00944225.0 00944225.0 KS SALINA KAAS-TV 11912 18 617. 00317 0390616.0 17 65. 00314 0390616.0 145100 11841.7 202136 15710.0 00972315.0 00972315.0 KS TOPEKA KSNT-DT 67335 27 1100. 00320 0390534.0 28 50.0 320.0 390534 438157 16547.7 468950 18415.4 009547 4.0 954704 KS TOPEKA KTKA-DT 49397 49 2690. 00453 0390134.0 48 121. 451.0 390134 455063 18227.3 505991
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A4.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A4.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3922A4.txt
  • 58.90 357. 48 840. 00357 2088547 25004.2 2201946 27050.2 IN EVANSVILLE WNIN 67802 09 316.00 177. 12 15. 00175 645351 17448.8 694926 19421.9 IN FORT WAYNE WANE-TV 39270 15 437.00 253. 31 82. 00253 611175 10033.6 887719 16885.0 KS LAKIN KSWK-TV 60683 03 100.00 171. 08 100. 00141 101752 21295.9 136446 29497.9 KS PITTSBURG KOAM-TV 58552 07 316.00 332. 13 4.2 00336 530378 28186.2 391964 19768.6 KY LEXINGTON WKYT-TV 24914 27 1510.0 300. 13 5. 00300 785753 16716.5 883620 21306.7 KY LEXINGTON WLEX-TV 73203 18 1100.0 195. 39 1000 00288 723838 12743.4 1041399 27471.9 LA BATON ROUGE WBRZ 38616 02 100.00 515. 13 30. 00515 2482199 40650.5 1975520 38816.8 LA MONROE KNOE-TV 48975 08 316.00 576. 07 5. 00519 695210 41172.5
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.txt
  • Resolution 49 (Rev.WRC-03) for the assignment with respect to the satellite that suffered the launch failure, if that information has not already been provided. If, within one year of the request for extension, the administration has not provided to the Bureau updated Resolution 49 (Rev.WRC-03) information for the new satellite under procurement, the related frequency assignments shall lapse. (WRC-03) ..... 4.2.6bis The regulatory time-limit for bringing into use of an assignment in the Region 2 Plan obtained through application of § 4.2 may be extended once by not more than three years due to launch failure in the following cases: - the destruction of the satellite intended to bring the assignment into use; - the destruction of the satellite launched to
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1925A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1925A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1925A1.txt
  • effective competition in the Dorr, Wayland Township and Gaines Franchise Areas under the low penetration effective competition test. Charter submitted information listed on Attachment A showing that its penetration rate in the Dorr Franchise Area is 28.2 percent; in the Wayland Township Franchise Area, its penetration rate is 18.1 percent; and, in the Gaines Franchise Area, the penetration rate is 4.2 percent. Accordingly, we conclude that that Charter has demonstrated the existence of low penetration effective competition under our rules in the Dorr, Wayland Township and Gaines Franchise Areas. ORDERING CLAUSES Accordingly, IT IS ORDERED that the petitions filed by Charter Communications for a determination of effective competition in the Communities listed on Attachment A ARE GRANTED. IT IS FURTHER ORDERED
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2017A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2017A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2017A1.txt
  • fire department, water district, public library, and school system, consisting of two elementary, two junior high, and one high school. Mayer has its own chamber of commerce, health care providers, and dozens of businesses, including many that include the word ``Mayer'' in their business names. The distance of Mayer from Prescott (26 kilometers) and their relative sizes (Mayer's population is 4.2 percent that of Prescott's) both compare favorably to those of other communities granted a first local preference. Moreover, 3 Point presents convincing evidence that Mayer residents perceive Mayer as separate from Prescott. We therefore find that Mayer is independent of Prescott and is entitled to preference for a first local service. 8. For all of the foregoing reasons, we conclude
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2640A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2640A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2640A1.txt
  • of EarlyBird-2. In April 1997, the Bureau granted DigitalGlobe a modification of its license to add two satellites, QuickBird-1 and QuickBird-2, to its EESS system. QuickBird-1 and QuickBird-2 were authorized to operate in the 8025-8345 MHz (downlink) frequency bands for EESS service. The Bureau also authorized DigitalGlobe to perform downlink TT & C operations for these two satellites in a 4.2 megahertz channel centered at 8030 MHz, and uplink TT & C operations in a 30 kilohertz channel in the 2025-2110 MHz band. In November 1997, the Bureau granted DigitalGlobe authority to add a 300 kHz channel at each of the 2085.6875 MHz and 2094.896 MHz center frequencies. In November 2000, QuickBird-1 was lost, due to a launch failure. Subsequently, DigitalGlobe
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-556A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-556A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-556A1.txt
  • F. Smith (202) 418-2180 B. MB Docket No. 04-302; RM-11020 Action: At the request of Charles Crawford, we are allotting Channel 271C3 at Lockney, Texas, as its first local aural transmission service. Coordinates: The reference coordinates for Channel 271C3 at Lockney are 34-05-00 North Latitude and 101-23-15 West Longitude. Additional Information: This allotment requires a site restriction of 6.7 kilometers (4.2 miles) southeast to avoid short-spacing to the vacant allotment site of Channel 269A at Turkey, TX and the license sites of FM Station KATP, Channel 270C1, Amarillo, Texas and Station KZII-FM, Channel 273C1, Clovis, New Mexico. FCC Contact: Rolanda F. Smith (202) 418-2180 C. MB Docket No. 04-303; RM-11025 Action: At the request of Charles Crawford, we are allotting Channel
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-1007A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-1007A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-1007A1.txt
  • in order to protect Channel 232C1 in Montreal, Quebec. Channel 282C3 at Keeseville, New York, has been accepted as a specially negotiated short-spaced allotment, with the following restrictions: the allotment is limited to 21.3 kilowatt (kW) ERP and 100 meters of antenna HAAT or the equivalent along the 16.9 degree azimuth towards Channel 282C1 in Trois-Rivieres, Quebec, and limited to 4.2 kW ERP and 100 meters of antenna HAAT or the equivalent along the 337 degree azimuth to protect Channel 281B, St. Jean, Quebec, and limited to 6.3 kW ERP and 100 meters of antenna HAAT or the equivalent along the 329 degree azimuth in order to protect channel 283B in Cornwall, Ontano. 7. The Commission will send a copy of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-121A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-121A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-121A1.txt
  • to the FCC Secretary from Josh L. Roland, Counsel to Globalstar LLC, dated Oct. 17, 2005 with attached letter from Anthony J. Navarra, President; letter to the FCC Secretary from Josh L. Roland dated Dec. 27, 2005. NTIA Letter at 5-6. ATC Report and Order at ¶23. ATC Second Reconsideration Order at ¶27. See ATC Report and Order, Appendix C3, §4.2.1. Other grandfathered incumbents in the 2483.5-2500 MHz band include stations in the fixed and mobile services that are licensed under Part 90 (Private Land Mobile Radio Services) or Part 101 (Fixed Microwave Services). See 47 C.F.R. §2.106, Footnote NG147. 47 C.F.R. § 25.254(b)(3). ATC Second Reconsideration Order at ¶94. Globalstar ATC Application, Exh. B at 4. Informal Objection of the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2365A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2365A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2365A1.txt
  • 195 ¶ 86. . We note that the Region 41 General Use wideband channels are not included in the instant Plan. Therefore, a Plan Amendment will have to be submitted and approved by the Commission before the wideband channels may be licensed. 47 C.F.R. § 90.527. . See supra note 2. Plan Section 4, Notification Process at 9; Plan Section 4.2, Election of Officers at 10, and Plan Section 5.1, Subcommittees at 11. Region 41 formed three subcommittees, Implementation and Technology, Interoperability, and 4.9 GHz. Plan Appendix H - Bylaws (revised April 2004). ). Plan Section 4.0, Notification Process at 9 (describing efforts to increase awareness and visibility for the planning process). Plan Supplement - Meeting Attendance (submitted Mar. 8, 2006).
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2439A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2439A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2439A1.txt
  • DIRECTV will protect those existing operations. Specifically, Spectrum 5 shall not operate the feeder links and service links originating or terminating in the United States on its Spectrum 1A and Spectrum 1B satellites in a manner that exceeds the limits in Annex 1 to Appendices 30 and 30A of the ITU Radio Regulations that trigger the agreement-seeking process under No. 4.2 of Appendices 30 and 30A at any location within the service areas of any affected operators that lie within the territory of the United States, until Spectrum Five has obtained the agreement of those operators. We also require Spectrum Five to submit evidence of these agreements to the Commission. Spectrum Five's satellite operations are not guaranteed protection from interference from
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2440A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2440A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2440A1.txt
  • situations as is the case here. Indeed, to ensure adequate protection for the existing Canadian DBS operations at 82º and 91º W.L., very substantial reductions of the power levels on the proposed EchoStar satellite would appear to be the only way that the MSPACE triggers could be removed.'' Any operations of EchoStar-86.5W will be subject to the provisions of Article 4.2 of Appendices 30 and 30A of the ITU Regulations. In addition, any operations of EchoStar-86.5W may continue even after launch of a satellite that would operate consistent with an entry in the ITU plan or pursuant to an earlier filed modification, upon a showing of coordination with such satellite. Absent coordination, continued operation is still possible within the confines of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.txt
  • greater protection provided to terrestrial services. Then, to protect broadcast systems and more narrowband systems, the pfd is translated into a 4 kHz bandwidth. Summary: The following pages indicate the modification to the IAP for agenda item 1.11 in strikethrough/underline format. VI MEETING OF PERMANENT CONSULTATIVE COMMITTEE II: RADIOCOMMUNICATIONS INCLUDING BROADCASTING October 25 to 28, 2005 San José, Costa Rica OEA/Ser.L/XVII.4.2 CCP.II-RADIO/doc. 896/05 Original: English INTER-AMERICAN PROPOSALS OF WSG-2 (Item on the Agenda: 4.1 ) (Document submitted by working sub-group 2 (WSG-2) ) Agenda Item 1.11: to review sharing criteria and regulatory provisions for protection of terrestrial services in particular terrestrial television broadcasting services, in the band 620 - 790 MHz from BSS networks and systems, in accordance with Resolution 545
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-1564A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-1564A2.txt
  • = DMIN + 3 dB to DMIN + 1 dB Change in U as D goes from DMIN+3dB to DMIN+1dB (dB) Extrapolated Change In U Adjusted Slope of Log-D Versus Log-U (dB/dB) Modeled Interference Mechanism Straight- Line Portion of Projection Deviation From Straight Line Total Measured Change in U Extrapolation Error (dB) N+1 1.3 AGC- Stabilized Nonlinear -2.0 -2.6 -4.6 -4.2 0.4 N+2 1.2 AGC- Stabilized Nonlinear -2.0 -2.6 -4.6 -4.7 -0.2 N+3 5.5 Cross- Modulation 0.0 -1.9 -1.9 -1.7 0.2 N+4 3.0 3rd Order -0.7 -1.3 -1.9 -1.8 0.1 N+5 3.2 3rd Order -0.7 -1.3 -1.9 -1.6 0.3 N+6 4.5 3rd Order -0.7 -1.3 -1.9 -1.2 0.8 N+7 6.3 Cross- Modulation 0.0 -1.9 -1.9 -2.4 -0.4 N+14 1.1 Linear -2.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.txt
  • Marine Construction, Inc., to Tracy Simmons, Federal Communications Commission; Letter dated Jan. 31, 2006 from Richard S. Becker, Richard S. Becker and Associates Chartered, counsel for B K Marine Construction, Inc., to Marlene H. Dortch, Secretary, Federal Communications Commission. See FCC File No. 0000598516. See license for Station WPTR255, Fort Pierce, Florida. See Petition at 1; Exhibits 4, 4.1 and 4.2. 47 C.F.R. § 90.157(a); see also 47 C.F.R. § 1.955(a)(3) (authorizations automatically terminate, without specific Commission action, if service is permanently discontinued). For the purposes of Section 90.157, any station which has not operated for one year or more is considered to have been permanently discontinued. 47 C.F.R. § 90.157(a). Pursuant to a Commission reorganization effective September 25, 2006, certain
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.txt
  • Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications Commission, dated July 13, 2005 (attaching the affidavit of Caroline Beasley, Vice President and Chief Financial Officer of Beasley Broadcast Group) filed
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A11.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A11.txt
  • generally highest during the second and third quarters of the year. Overall, since 1996 the gross profit margins of the radio companies have shown very strong performance in comparison with the S&P 500 companies. The year 2001 is a notable exception, but since the beginning of 2002, radio company margins have been above those of the S&P in every quarter. 4.2 Net Profit Margins The Net Profit Margin is defined as the ratio of a firm's net income to its sales. Thus, the Net Profit Margin reflects the operating performance of the firm after netting out interest and taxes from the EBIT Margin. A comparison of Chart V (EBIT Margins) with Chart VI (Net Profit Margins) suggests that while radio companies
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A2.txt
  • TOTAL, WATCHING OR LISTENING TO CABLE OR SATELLITE TV CHANNELS? BASE: RESPONDENTS WHO SUBSCRIBE TO CABLE OR SATELLITE TV TOTAL =========== 26 HOURS TO LESS THAN 27 HOURS 0.0 27 HOURS TO LESS THAN 28 HOURS - 28 HOURS TO LESS THAN 29 HOURS 1.3 29 HOURS TO LESS THAN 30 HOURS - 30 HOURS TO LESS THAN 31 HOURS 4.2 31 HOURS TO LESS THAN 32 HOURS 0.0 32 HOURS TO LESS THAN 33 HOURS 0.1 33 HOURS TO LESS THAN 34 HOURS 0.1 DATA BASED UPON FEWER THAN 145 RESPONDENTS DO NOT MEET MINIMUM REPORTING STANDARDS AND ARE SUPPLIED FOR INTERNAL USE ONLY. COPYRIGHT © THE NIELSEN COMPANY NIELSEN MEDIA RESEARCH FCC PHONE SURVEY MAY 2007 PAGE: 17 TABLE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A4.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A4.txt
  • damentaldifferenceinthereportingofbroadcastandcabletelevisionprogramminginthedata. 20Forexample,therearetwoABCaffiliatesinthe7th-largestDMA:WCVB(Boston,MA)andWMUR(Manch- ester,NH).Ofthese,WCVBhasthe(much)higheraverageratingacrosstheprogramsinourdata:4.82versus0.96. WethereforedroppedfromtheanalysisWMUR,alongwithall234othernetworkaffiliatesforwhichtherewasa secondaffiliatewiththesamenetworkwithinthesameDMAthathadhigherratings.Therewere7instancesof multiplenetworkaffiliatesforwhichneitherhadanyratingsinformationinthedata.Inthesecases,weassumedthey couldeachreach50%ofthehouseholdsintheDMA. 21Theleastwidelydistributedbasiccablenetwork(HTVMusica)wasavailableinjust2.0millionhouseholds. 22AbrieflookatthefullTMSdatashowsthattheyareontherise:from776inMay2003to1,235inNovember 2006. 23ThismayseemanimportantomissiongiventheFCC'scurrentandhistoricfocusonlocalism(cf.FCC(2003)), butweconcludedadetailedanalysisofthemanyvarietiesoflocaloriginationwasbeyondthescopeofthisstudy. Thedataexist,however,foradetailedanalysisoflocallyavailablecableprogramming.AsforLPTVstations,we cansaythattheirnumberhasgrowninthesample,from484inMay2003to697inNovember2006. 10 Inourestimationdataset,thereare1,583broadcastaffiliatesand192cablenetworks.Muchof theprogrammingonthebroadcastnetworks,however,issimilar,particularlyduringprimetime (8:00-11:00EST).24Evenifnot,itisprovidedwithinaDMAwhileeachofthecablenetworkscan (atleastinprinciple)bedistributednationally.Inordertocompareprogramming,atleastona nationalbasis,wehadtosomehowaggregatetheinformationabouttheprogrammingprovidedon broadcastaffiliatesintosomethinglikea"national"broadcastnetwork. Thisproblemwasconceptuallyeasyfortelevisionstationsaffiliatedwithabroadcastnetwork: simply"addup"(withappropriateweights)theprogrammingprovidedoneachaffiliate.We describeindetailhowwedidthisinthenextparagraph.Buthowshouldone"addup"themany independentandpublictelevisionstations?Whilemanyassumptionsarepossible,wechoseto makeseveral"virtualnetworks"ofthesestations.25Takeindependentstationsforclarity(public stationsweretreatedsimilarly).Weexaminedalltheindependenttelevisionstationswithineach DMAintheU.S.andrankedthemaccordingtotheirchannelnumber(withlowchannelnumbers atthetopofthelist).26Wethenmadea"network"ofallofthe"first"independentstations.Call this"network""Independent1".Wemadesimilar"networks"outofeachofthesecond,third, etc.stationsuntilweranoutofstations.Thisyielded9independenttelevision"networks"and6 publictelevision"networks".Table5reportsthenumberofaffiliatesforeachofournetworksin theestimationdata.Tables27and28reporttheidentitiesofthecablenetworksinthedata.27 Havingidentifiedeachbroadcastnetwork(realorvirtual),wenextfacedthetaskofaggregating theseacrossthevariousDMAsintoasinglenationalnetwork.Butwhatdoesitmeanto"add up""WheelofFortune"inSanDiegowith"EntertainmentTonight"inTampa?28Whilewecan't aggregateprogramnames,wecanaggregatethecharacteristicsofthoseprograms.Considerthe TVContentRatingforclarity.29"WheelofFortune"inSanDiegohasaTVContentRatingof TV-G(giveitavalueof3)while"EntertainmentTonight"isn'trated(giveitavalueof0).Adding upthetvratingsofthesetwoprograms(andacrossalltheprogramsonagivennetworkforagiven dayandtimeperiod)givesbothan"average"TVratingaswellastheshareofaffiliatesthathave eachrating.30WedothisnotonlyforTVContentRatings,butforallthecharacteristicsofthe 24Afterstandardizingfordifferencesintimezones,itwastypicalforeveryaffiliateofthefourbigbroadcastnetworks (ABC,CBS,NBC,andFOX)intheUnitedStatestocarrythesameprogram. 25Thishadtheadvantageofcapturingthefactthathouseholdsinsome(larger)DMAshaveaccesstomore independentandpublictelevisionstationsthanhouseholdsinotherDMAs. 26Channelnumberishistoricallyimportantassignalqualityviaover-the-airbroadcastwasgenerallyhigherthe lowerthechannelnumber. 27Thereappeartobeafewidiosyncraciesinthenetworksreportedtousbythedataproviders.Forexample,we receivedanumberofthepremium"multiplexes"(e.g.Showtime,Starz)butnotothers(e.g.HBO,Cinemax).This isunlikelytodramaticallyaffectourconclusions. 28Notethisisn'tnearlyasmuchaproblemforthemajorbroadcastnetworksinprimetime.There,theuniformity ofprogrammingacrossaffiliatesmeanswecansimplyreporttheprogrambeingshownonalltheaffiliates. 29Thetelevisioncontentratingisamethodofdescribingthesuitabilityofparticularcontentforparticularaudiences. TheyaresimilartoMPAAratingsformovies.Wedescribetheminfurtherdetailbelow. 30Forexample,theaverageTVcontentratingofprogramsonNBCaffiliatesat7:00p.m.(moregenerally,one 11 programmingprovidedtousbyTMS(ordefinedbyususingTMSdata).Thisyieldsapicture ofwhatthe"average"televisionstationaffiliatedwitheachnetworkisbroadcastingforagiven quarter-hourofagivenday. 4.2ProgrammingTypes WearenowpreparedtodescribepatternsoftelevisionprogrammingintheUnitedStates,bothin generalandwithrespecttotheprogrammingtypesarticulatedbytheFCCwhencommissioningthis study.Theyaskedafter7programmingtypes:(1)LocalNewsandPublicAffairsProgramming, (2)MinorityProgramming,(3)Children'sProgramming,(4)FamilyProgramming,(5)Indecent Programming,(6)ViolentProgramming,and(7)ReligiousProgramming.Thissectiondescribe howwedefinedeachofthesetypesofprogramming. Weusedtwoprimarypiecesofinformationindefiningprogrammingtypes.Themostusefuland accuratewastoexploitinformationintheProgramTypeandCategoryfieldsinthedataprovided tousbyTMS.31Forexample,wedefinedaprogramtobea"News"programifeithertheProgram TypeorCategorywas"News".Whileveryusefulforsomeprogramtypes,however,theTMS dataprovedlessusefulforothers(e.g.MinorityProgramming).Oursecondwayofdefining programtypeswasthereforetoidentifythetargetaudience(ifoneexisted)forbroadcastandcable televisionnetworksandassumethatallprogrammingprovidedonthatnetworkwasthattype ofprogramming.Forexample,wedefinedalltheprogrammingshownonBlackEntertainment Televisiontobeminority-targetedprogramming.Thespecificrulesforeachtypeofprogramming aredescribedbelow. 1.NewsandPublicAffairsProgramming. Asnotedabove,wedefinedprogrammingtobenewsprogrammingifeithertheProgram TypeorCategorywas"News".Similarly,wedefinedprogrammingtobePublicAffairs ProgrammingiftheProgramTypewas"PublicAffairs".Wefurtherdistinguishedbetween NetworkNewsandLocalNewsonbroadcasttelevisionnetworksbyexamininghowoftena particularprogramtitleappearedacrossalltelevisionstations.Ifithadover1,000quarter- hoursinthedata,wedefinedthattobeanetworknewsprogram.32Allothernewsprograms weredefinedaslocalnewsprograms. hourbeforeprimetime)onNovember15,2006amongprogramsthatgiveratingsis3.4(abouthalfwaybetween TV-GandTV-PG).Orifmoredetailiswanted,ofthe187NBCaffiliatesinourestimationdataset,65.2%didn't ratetheirprogram,21.4%showedprogrammingratedTV-G,12.8%showedprogrammingratedTV-PG,and0.5% showedprogrammingratedTV-14. 31Table4listsour(shortened)versionsofthesefields.Appendix7describestherulesTMSusestoallocate programmingtotheir33programtypes.AccordingtodiscussionswithseniorTMSpersonnel,programmingis allocatedto"Categories"firstaccordingtoanyinformationprovidedbytheprogramproviderinpresskits,program schedules,etc.IftheCategoryisstillunclear,theEditorialDepartmentstaffqueriesthemforthisinformation. 32Aone-hourlocalnewsprogramshownonceperdayforeverydayinourdatawouldshowupfor224quarter- 12 2.MinorityProgramming. Wedistinguishedbetweenprogrammingtargetingthreetypesofaudiences:Blackaudiences, Latino/Spanish-speakingaudiences,andotherminorityaudiences(e.g.International,East Asian,SouthAsian,Gay&Lesbian,etc.)Weoffertwokindsofdefinitions.First,we wentthroughthelistof192cablenetworksanddecidedifanyofthesenetworkstargeted anyoftheseminoritygroups.Thenetworkswechoseforeachofourthreeaudiencesis detailedinAppendixB.Thisisunfortunatelycrude,however,assomeprogrammingoffered onother(includingbroadcast)networksclearlytargetsminorityaudiences.WhileTMS didn'tprovideinformationabouttheotherminorityaudiences,wedefinedanyprogramming witha"Spanish"or"Pelicula"ProgramTypeorCategorytotargetLatino/Spanish-speaking audiences. 3.Children'sProgramming. Wehadtwodefinitionsforchildren'sprogramming.First,wedefinedaprogramasachildren's programifit'sProgramTypeorCategorywas"Children".Second,wedefinedaprogramas achildren'sprogramifitwasamoviewithanMPAAratingof"G"oratelevisionprogram withaTelevisionContentratingofTV-YorTV-Y7.33 4.FamilyProgramming. Wehavethreedefinitionsoffamilyprogramming.First,wearticulatedthesetofcable networksthatprovidefamilyprogramming.34Second,wedefinedaprogramasafamily programifithadaTelevisionContentratingofTV-G.Third,wedefinedaprogramasa familyprogramifithadanArts,Educational,orDocumentarytheme.35 5.IndecentProgramming. WedefinedindecentprogrammingasAdultProgramming.36Wehavetwomeasures.First, wedefinedallprogrammingonanetworkshowingprogrammingwithstrongsexualcontent asadultprogramming.Second,wedefinedasadultprogramminganymoviewithanMPAA ratingofNC-17oranytelevisionprogramwithaTelevisionContentratingofTV-MA-S
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A5.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A5.txt
  • marginal effect is small, about 25 seconds (8%) of additional news per additional segment recorded during evening drive. Finally, the estimation provides no evidence that FM stations were more or less likely to air news than AM stations. Among those stations that might air some news, however, FM stations aired significantly less news by a factor of exp(-0.97) or 0.38. 4.2 Local News The results for the same specification estimated over local news are shown in Table II-8. We again focus on the case in which the EMR data were used to generate the dependent variable. Among the variables included to capture ownership characteristics, the parameter estimates are largely similar to those of the news estimations. As we saw in the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A7.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A7.txt
  • radio station 1.2 (0.32) 1.8 (0.49) 4.1 (1.13) 2.4 (0.59) Cross-owned radio and newspaper 2.9 (0.55) 3.5 (0.61) 2.3 (0.40) 5.1 (0.80) Parent company coverage of all television households (%) 0.2 (0.84) 0.1 (0.38) 0.3 (1.23) Network owned and operated -6.2 (1.19) -6.9 (1.25) -10.5* (1.77) Network affiliation (omitted category is CW\MyNetwork) ABC -2.1 (0.61) -4.5 (0.83) CBS -0.7 (0.21) -4.2 (0.68) FOX 5.8 (1.63) 9.2** (2.33) NBC -1.0 (0.30) -4.3 (0.70) Other control variables Time and length of broadcast fixed effects No No No No Yes DMA and date fixed effects Yes Yes Yes Yes Yes Adjusted R-squared .02 .01 .01 .02 .02 Notes: Absolute values of t-statistics in parentheses (using heteroscedastic-consistent standard errors corrected for clustering by television station);
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A8.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A8.txt
  • ofnon-farmbusinesses.Inthecaseofthethreemediaindustriesanalyzedhere,Blacksown aslightlylargershareofthesebusinessesthantheyownoftheeconomyasawhole,but stillmuchlessthantheirshareofthepopulation.Asiansownamorethanproportionate shareofTVstations,butareunder-representedinRadioandNewspapers,whileAmerican IndiansownaclosetoproportionateshareofNewspapers,butareunder-representedin RadioandTelevision.Hispanicsareunder-representedacrosstheboardbut,aswithevery othercategory,notmoresointheseindustriesthaninthepopulationofÖrmsatlarge.As isthecasewithfemaleownership,thedatarevealthatthesethreeindustriesarenotout oflinewiththeeconomyasawhole.Under-representationoffemalesandminoritiesisan economy-widephenomenon,itisnotindustryspeciÖc. 2.2SourcesofAsymmetries Sincetheobservedownershipasymmetriesareeconomy-wide,theyareundoubtedlylinked tobroadsystematicfactors.Whilesomeofthispatternmaywellbeduetodiscrimination, themostdirectexplanationliesinunequalaccesstocapital(whichmayitselfberootedin discrimination,orotherlongstandingdisadvantages).Whyisaccesstocapitalimportant? ManybusinessesrequireindividualstosinksubstantialÖnancialinvestmentsuponentry. Thisislikelytobeespeciallytrueinmediaenterprises,giventherelativelyhighlevelsof Örmconcentration.Table9intheappendixshowsthesharesofthetop4,top8,top20, andtop50Örmsinfullsetofindustriesforwhichwehavedata.Theconcentrationratios intheinformationcategoryandspeciÖcallyinRadioandTVbroadcastingareveryhigh. 8 Table4:FamilyNetWorth(2004dollars,thousands) 1989 1992 1995 Ethnicgroup MedianMeanMedianMeanMedianMean Whitenon-Hispanic 104.2333.4 91.9292.9 94.3308.7 NonwhiteorHispanic 9.8 92.1 15.8102.0 19.5 94.9 ratio 10.6 3.6 5.8 2.9 4.8 3.3 1998 2001 2004 MedianMeanMedianMeanMedianMean Whitenon-Hispanic 111.0391.1 130.2520.2 140.7561.8 NonwhiteorHispanic 19.3116.5 19.1125.1 24.8153.1 ratio 5.8 3.4 6.8 4.2 5.7 3.7 Thisisindicativeofhighbarrierstoentry,mostlikelyintheformofcapitalrequirements. Forexample,eveninRadio,wherethecapitalrequirementsarearguablythelowest,basic startupcostsforalowpowerFMstationareontheorderof$160,000forequipmentalone.2 HighpowerradioandTVareordersofmagnitudemoreexpensive.Thus,akeydeterminant ofmediaownershipissimplybeingabletoa§ordit.Thisabilityvariessharplybyrace. Sohowmuchdoesaccesstocapitalvarybyrace?Toanswerthisquestionweturned totheSurveyofConsumerFinances,whichisconductedeverythreeyearsbyresearchers attheU.S.FederalReserve(Fed).TheFedsurveysabout4,500U.S.households,asking familiesabouttheirpersonalÖnances,useofÖnancialinstitutions,income,pensions,and additionaldemographicinformation.Sincetheindustriesweareinterestedininvolvelarge Öxedinvestments,thequestionofaccesstocapitalisparamount.Themeansandmedians byethnicgrouparereportedinTable4. Unfortunately,theracialbreakdownusedbytheFedisnotasÖneasintheSBO, butitisstillinformative.Inparticular,weseethattheaverageratioofmeannetworth betweenwhitesandnonwhitesduringtheperiodreportedinTable4was3.5in2004, whiletheaverageratioofmediannetworthbetweenwhitesandnonwhiteswasabout6.6. Thesenumberssuggestthat,intermsofaccesstopersonalcapital,thereisagreatdealof inequalityacrossthesegroups.3Coupledwiththedi§erencesinpopulation,wecanstart 2Forinformationonthebasicequipmentnecessarytostartaradiostation,alongwithestimatedcosts, seehttp://www.christianradio.com/sterling/enhanced.html. 3Ofcourse,drawingonpersonalwealthisnottheonlywaytoÖnancealargeproject,individualscan 9 Table5:OwnershipPatterns(Whitevs.non-White) Radio TV Newspaper All StationsStationsPublishersNon-Farm White 89.9 84 91.9 88.1 NonwhiteorHispanic 10.1 16 8.1 11.9 Ratio 8.9 5.25 11.3 7.4 tounderstandwhythereissuchskewnessinownership.Theratioofwhitestonon-whites inthepopulationatlargeisabout2.2to1whiletheratioofwealthisbetween3.6and5.7 to1,yieldinganoverallratioofbetween7.7and14.5to1.Thismeansthatnon-minorities haveaccesstobetween8to14timesasmuchpersonalcapitalasminorities.Basedonthis alone,wewouldexpectownershipratestofollowasimilarpattern,whichtheyinfactdo. Table5showstheratiosofwhitetonon-whiteorHispanicownersforthethreeindustries underanalysishere,aswellastheoverallnon-farmeconomyasawhole.WeÖndtheratios areverymuchinlinewiththerelativeratiosofwealth,suggestingthataccesstocapitalis indeedtheprimaryfactordrivingtheasymmetriesofownershipamongtheraces.Thisdoes notinanywayexcusethislargedegreeofinequality,itmerelyidentiÖesitscause:non- minoritiescontrolamuchlargerfractionofaggregatewealththanminorities,allowingthem toownamuchlargerfractionofbusinesses.Assumingthataggregatewealthisastrong indicatoroftheabilitytoÖnancelargecommercialventures,inordertochangeownership patternsweneedtoeitherchangetheaggregatedistributionofwealthorotherwiseincrease accesstocapitalmarkets.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3915A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3915A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3915A1.txt
  • Goldendale, Washington, Notice of Proposed Rulemaking, 20 FCC Rcd 1287 (MB 2005). See Monument, Oregon, Order to Show Cause, 21 FCC Rcd 3332 (MB March 31, 2006). Comments of Cumulus Licensing LLC to Order to Show Cause, MB Docket 05-10, May 2, 2006. See Ione, Oregon, Report and Order, 21 FCC Rcd 10017 (MB 2006). See PB APA at § 4.2(a). The Bicoastal APA also provides for the sale of Stations KACI(AM), The Dalles, Oregon, as well as KIHR(AM) and KCGB-FM, Hood River, Oregon, from CGB to Bicoastal. Additionally, the Bicoastal APA provides for the sale of Station KMSW(FM), The Dalles, Oregon, from M.S.W. Communications, LLC to Bicoastal. The proposed assignment of Station KACI-FM to Bicoastal is the only one of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1094A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1094A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1094A1.txt
  • Table C5 are considered to fall outside of the U.S./Canada border area and may operate according to the non-border band plan listed in § 90.617. TABLE C5 - CITIES THAT ARE CONSIDERED TO FALL OUTSIDE THE CANADA BORDER REGION Location Coordinates Latitude Longitude Akron, Ohio Youngstown, Ohio Syracuse, New York 41( 05' 00.2" N. 41( 05' 57.2" N. 43( 03' 04.2" N. 81( 30' 39.4" W. 80( 39' 01.3" W. 76( 09' 12.7" W. (6) The channels listed in Table C6 and paragraph (c)(6)(i) of this section are available in the Canada Border Regions for non-cellular operations to eligible applicants in the Public Safety Category which consists of licensees eligible in the Public Safety Pool of subpart B of this part.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.txt
  • the victim receiver in a minimum desired signal condition to represent a worst-case interference scenario. Section 4.1 describes a test performed to assess potential adjacent-channel and co-channel interference interactions when a proximate DTV receive system is tuned to a station near the recognized threshold of visibility (TOV) of -84 dBm. This test was performed within the FCC laboratory facility. Section 4.2 describes tests performed at two of the residential field trial sites to assess the potential for interference to the reception of cable television programming via the direct pick-up of an undesired WSD-transmitted signal either by the coaxial cable/connections, the television tuner and/or a set-top converter box. In these tests, the precise interference entry point was not identified. Channel Interference Potential
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.txt
  • and regulatory directives, including the following: Determine when to initiate NPA Relief by continually monitoring CO Code growth and projecting exhaust. Upon the identification of a potential exhaust situation, notify appropriate regulatory authorities and affected parties within the NPA. If necessary, immediately organize a relief-planning meeting to obtain local industry consensus and subsequent regulatory direction for a relief implementation plan. 4.2.6 Management of Jeopardy Conditions The NANPA shall: Declare a jeopardy NPA condition within any NPA that meets the conditions established in the appropriate industry guidelines and regulatory orders. Monitor CO Code growth and projected exhaust. Notify appropriate regulatory authorities and affected parties within the NPA. Notify the industry that jeopardy code rationing is available if so desired, or may be
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1994A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1994A2.txt
  • correlationoftheindicationthatfrequencyassignmentshavebeenbroughtintousewitha particularsatellitenetwork; 4 toincludeonthiswebsiteahyperlinktotheassociatedResolution49data,submittedon orafterthedateofbringingintouse,fortheparticularfrequencyassignmentsandsatellite network. Reasons: ToimprovetransparencyintoGSaresourcesactuallybeingusedbymakingbringingintouse dataforfrequencyassignmentsandsatellitenetworksreadilyavailable. 35 USAlxx/2 MOD Theuncertaintyassociatedwithwhenfrequencyassignmentsareactuallybroughtintouseand withpossibleinaccuracieswithResolution49Annex2datacanbeaddressedasfollows: RESOLUTION49(Rev.WRC-12Q+) Administrativeduediligenceapplicabletosomesatellite radiocommunicationservices TheWorldRadiocornrnunicationConference(Geneva,20129+), considering a) thatResolution18ofthePlenipotentiaryConference(Kyoto,1994)instructedthe DirectoroftheRadiocommunicationBureautoinitiateareviewofsomeimportantissues concerninginternationalsatellitenetworkcoordinationandtomakeapreliminaryreportto WRC-95andafinalreporttoWRC-97; b) thattheDirectoroftheBureauprovidedacomprehensivereporttoWRC-97,includinga numberofrecommendationsforactionassoonaspossibleandforidentifyingareasrequiring furtherstudy; c) thatoneoftherecommendationsintheDirector'sreporttoWRC-97wasthat administrativeduediligenceshouldbeadoptedasameansofaddressingtheproblemof reservationoforbitandspectrumcapacitywithoutactualuse; d) thatexperiencema)'needtobegainedintheapplicationoftheadministrativedue diligenceproceduresadoptedbyWRC-97indicatescertainchangesshouldbemadetothose procedures,andthatse't'eralyearsmaybeneededtosee't','hetheradministrativeduediligence measuresproducesatisfactoryresults; e) thatnewregulatoryapproachesmayneedtobecarefullyconsideredinordertoavoid adverseeffectsonnetworksalreadygoingthroughthedifferentphasesoftheprocedures; f) thatArticle44oftheConstitutionsetsoutthebasicprinciplesfortheuseoftheradio- frequencyspectrumandthegeostationary-satelliteandothersatelliteorbits,takingintoaccount theneedsofdevelopingcountries, consideringfurther g) thatWRC-97decidedtoreducetheregulatorytime-frameforbringingasatellitenetwork intouse; h) thatWRC-2000hasconsideredtheresultsoftheimplementationoftheadministrative duediligenceproceduresandpreparedareporttothe2002PlenipotentiaryConferencein responsetoResolution85(Minneapolis,1998), resolves 1 thattheadministrativeduediligenceprocedurecontainedinAnnex1tothisResolution shallbeappliedasfrom22November1997forasatellitenetworkorsatellitesystemofthefixed- satelliteservice,mobile-satelliteserviceorbroadcasting-satelliteserviceforwhichtheadvance publicationinformationunderNo. 9.2B,orforwhichtherequestformodificationsofthe Region2PlanunderArticle4, §4.2.1b)ofAppendices30and30Athatinvolvetheadditionof newfrequenciesororbitpositions,orforwhichtherequestformodificationsoftheRegion2 PlanunderArticle4, §4.2.1a)ofAppendices30and30Athatextendtheserviceareatoanother 36 countryorcountriesinadditiontotheexistingservicearea,orforwhichtherequestforadditional usesinRegions1and3under §4.1ofArticle4ofAppendices30and30A,orforwhichthe submissionofinformationundersupplementaryprovisionsapplicabletoadditionaluses inthe plannedbandsasdefinedinArticle2ofAppendix 30B(Section illofArticle6)hasbeen receivedbytheBureaufrom22November1997,orforwhichsubmissionunderArticle6of Appendix 30B(Rev.WRC-07)isreceivedonorafter17November2007,withtheexceptionof submissionsofnewMemberStatesseekingtheacquisitionoftheirrespectivenationalallotmentsI forinclusionintheAppendix 30BPlan; 2 thatforasatellitefletworkorsatellitesystem't't'ithiflthescopeof§1or3ofAflfle)(1to thisResolutioflflOtyetrecordedifltheMasterlRterflationalFrequeflcyRegister(MIFR)by 22November1997,forwhichtheadvancepublicationinformatiofluflderNo. 1042oftheRadio Regulations(Editionof1990,revisedin1994)orfortheapplicatioflofSectionIIIofArticle6of Appefldix JOBhasbeeflreceiyedbytheBureaubefore22November1997,theresponsible admiflistratioflshallsubmittotheBureauthecompleteduediligeflceiflformationinaccordaflce ',yithAflflex2tothisResolutioflflOtlaterthan21No,>'ember2004,orbeforethem(piryofthe notifiedperiodforbringiflgthesatellitenetworkintouse,plusanyextensionperiod'""hichshall flOtexceedthreeyearspursuanttotheapplicationofNo. lSSOoftheRadioRegulations(Editiofl of1990,revisedin1994)orthedatesspecifiedinthereleyantprovisionsArticle6of Appefldi)( JOB,'t',rhiche,>rerdatecomesearlier.Ifthedateofbriflgingifltouse,includiflgextension specifiedabove,isbefore1July1999,theresponsibleadministrationshallsubmittotheBureau thecompleteduediligeflceinformationiflaccordaflcewithAflfle)(2tothisResolutioflnotlater than1July1999;(Reason:Overtakenbytime) 2his thatforasatellitefleh't'orl(orsatellitesystem't'lithiflthescopeof§2ofAflnex1tothis ResolutioflnotrecordedintheMIFRb)'22NO't'ember1997,forwhichtherequestfora modificatiofltothePlansofAppendices JOandJOAhasbeenreceivedbytheBureaubefore 22November1997,theresponsibleadministrationshallsubmittotheBureauthecompletedue diligeflceinformationinaccordancewithAflfle)(2tothisResolutioflasearlyaspossiblebefore theefldoftheperiodestablishedasalimittobringingintouseiflaccordaflcewiththerelevaflt provisioflsofArticle4ofAppefldi)( JOafldtherelevantprovisionsofArticle4ofAppefldix JOA; (Reason:Overtakenbytime) See§2.3ofAppendix30B(Rev.WRC·07). 37 3 thatforasatellitenetworkorsatellitesystem'tyithinthescopeof§1,2or3ofAnne),1to thisResolutionrecordedintheMIFRby22No',cember1997,theresponsibleadministrationshall subrllittotheBureauthecompleteduediligenceinformationinaccordancewithAnnex2tothis Resolutionnotlaterthan21NO't'ember2000,orbeforethenotifieddateofbringingthesatellite networkintouse(includinganymttensionperiod),>tYhiche't'erdatecomeslater;_(Reason: Overtakenbytime) 4 thatsi),monthsbeforetheexpirydatespecifiedin
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2088A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2088A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2088A1.txt
  • see also Plan, Appendix C - List of Meetings Held at C1; Plan, Appendix D - Meeting Minutes and Announcements at D1-D74. See Plan, Section 3 - Allocation of General Use Spectrum at 14-16; see also Plan, Section 3.4 - Region 13 Application Requirements at 18-19. See Plan, Section 4.0 - Processing and Evaluating Applications at 24-28. See Plan, Section 4.2 - Evaluation Matrix Point System (scoring based on system type, implementation factors, intersystem interoperability, loading requirements and system density/geographic efficiency). See Plan, Appendix J - Letter dated October 31, 2001 from Governor George H. Ryan, State of Illinois to D'Wana Terry, Chief, Public Safety and Private Wireless Division, Wireless Telecommunications Bureau, FCC (affirming Illinois Statewide Radio Communications Steering Committee (I-STAR)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-442A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-442A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-442A1.txt
  • band plan for Canadian Border Regions 7A and 7B as indicated below. TABLE C5 - CITIES THAT ARE CONSIDERED TO FALL WITHIN CANDIAN BORDER REGION 7 Location Coordinates Canadian Border Region Latitude Longitude Akron, Ohio 41( 05' 00.2" N. 81( 30' 39.4" W. 7A Youngstown, Ohio 41( 05' 57.2" N. 80( 39' 01.3" W. 7A Syracuse, New York 43( 03' 04.2" N. 76( 09' 12.7" W. 7B * * * * (7) * * * TABLE C7 - GENERAL CATEGORY 806-821/851-866 MHz Band CHANNELS IN THE CANADA BORDER REGIONS. Canada Border Region General Category channels where 800 MHz high density cellular systems are prohibited. General Category channels where 800 MHz high density cellular systems are permitted. * * * * *
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.txt
  • 0.7% 2.0% 2006 price compared to Noncompetitive group -6.4% -0.2% -4.9% -20.2% -20.6% Sources: Attachments 2 and 3. As shown in Table 1-a, for the period between January 1, 2006 and January 1, 2007, the average price for expanded basic service increased by 4.6 percent, from $45.18 to $47.27. Over that period, the price of basic cable service increased by 4.2 percent, from $14.70 to $15.33, and the price of cable programming service increased by 4.8 percent, from $30.48 to $31.94. On average, the prices of expanded basic service in noncompetitive communities and communities relieved from rate regulation increased by 4.3 percent and 6.1 percent, respectively, during that period, to $47.49 and $46.28. Table 1-a Monthly Prices 2007 Programming Service January
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-54A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-54A1.txt
  • 13 percent.570 M:Metrics also found that nearly 31 percent of iPhone users watched mobile TV or video, versus a market average of 4.6 percent and more than double the rate for all "smartphone" users (14.2 percent). 571 In addition, nearly 50 percent of iPhone users accessed a social networking site or blog, versus 19.4 percent of "smartphone" users and a 4.2 percent market average.572 The data also reveal that two of the iPhone's featured "widgets," YouTube and Google Maps, are very popular among iPhone users, as is Facebook, one of the first Web properties to customize its content for the iPhone.573 M:Metrics argues that the dramatic increase in mobile content consumption among iPhone users is due not only to the attributes
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.txt
  • at 27-42 (seven meetings held over the course of a six-year period). See Revised Plan, Section 4.1.a Procedure for Requesting Spectrum Allocations at 6; see also Revised Plan, Section 4.3 Allocation of Narrowband ``General Use'' Spectrum (narrowband pool allotments have a channel bandwidth of 25 kHz to provide flexibility to accommodate multiple technologies using multiple bandwidths). See Revised Plan, Section 4.2 Procedure for Frequency Coordination at 8. See Revised Plan, Section 5.0 System Design/Efficiency Requirements (interference protections criteria, spectrum efficiency standards and the handling of ``orphaned'' channels) at 13-14. Revised Plan, Section 6 Interoperability Channels (addressing tactical channels, deployable systems and the monitoring of Calling Channels); see also Revised Plan, Appendix E - NCC Implementation Subcommittees Table of Interoperability Channels. See
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1234A1_Rcd.pdf
  • the Commission's Form 477 data collection, including collecting broadband availability data at the census block level by provider, technology, and offered speed. The Plan recommended that availability for mobile service be defined in terms of coverage specifications determined by the Commission and include information on spectrum used by facilities-based providers. See Connecting America: The National Broadband Plan, FCC, at Recommendation 4.2 (rel. Mar.16, 2010), available at www.broadband.gov. 15"Comment Sought on Measurement of Mobile Broadband Network Performance and Coverage," CG Docket No. 09-158, CC Docket No. 98-170, WC Docket No. 04-36, Public Notice, DA 10-988, at 3 (rel. Jun. 1, 2010). 16NTIA Unveils Program to Help States Map Internet Infrastructure, Press Release, NTIA, July 1, 2009, available athttp://www.ntia.doc.gov/press/2009/BTOP_mapping_090701.html; NTIA to Accept Updated
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1258A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1258A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1258A1.txt
  • 9, 2009) (``LOI Response''). 47 C.F.R. § 4.9(f). See also supra, ¶ 4. 2004 Network Outage Order, 19 FCC Rcd at 16868 ¶ 69. See id. at 16834 ¶ 3, 16868 ¶¶ 73-75. In the 2004 Network Outage Order, the Commission afforded confidential treatment to network outage reports. 2004 Network Outage Report, 19 FCC Rcd at 16853-55, ¶¶ 42-46. Section 4.2 of the Rules specifically states that Part 4 outage reports ``will be presumed to be confidential'' and that public access to outage reports may be sought only pursuant to the procedures set forth in Section 0.461 of the Rules which addresses requests for inspection of materials not routinely available for public inspection. 47 C.F.R. § 4.2; see also 47 C.F.R.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1348A1_Rcd.pdf
  • Line Rental/Leasing Charge Modem Rental Charge Broadband Bundled part of Double Play/ Triple Play ? Length of ServiceContract Promot-ional Price Usage limit Broadband Provider's URL Telerena Entrant BN1 unclear 3.2 Mbps down National Euro 66 $37.16 n/a Registration: 200 n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 month contract, free registration Telerena Entrant CN1 unclear 4.2 Mbps down National Euro 101 $56.87 n/a Registration: 200 n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 Telerena Entrant DN1 unclear 4.2 Mbps down National Euro 120 $67.57 n/a Registration: 200 n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 month contract, free registration Telerena Entrant Quality Plans: A1 unclear 3.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1348A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1348A2.txt
  • Mbps down National Euro 37 $20.83 n/a Registration: 200n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 month contract, free registration www.splius.lt/Internetas/Kainos/ Telerena Entrant BN1 unclear 3.2 Mbps down National Euro 66 $37.16 n/a Registration: 200n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 month contract, free registration Telerena Entrant CN1 unclear 4.2 Mbps down National Euro 101 $56.87 n/a Registration: 200n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 Telerena Entrant DN1 unclear 4.2 Mbps down National Euro 120 $67.57 n/a Registration: 200n/a month to month w/ 12 month contract, registration fee: 50; w/ 24 month contract, free registration Telerena Entrant Quality Plans: A1 unclear 3.2 Mbps down
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1607A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1607A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1607A1.txt
  • in the development of coordinated regional plans, and developed a Regional Planning Guidebook. Following the sunset of the NCC's charter on July 25, 2003, the National Public Safety Telecommunications Council (NPSTC) agreed to continue to provide assistance to regional planners. A copy of the 700 MHz Regional Planning Guidebook is available at the NPSTC website at http://www.npstc.org/nccsubcom.jsp. See Plan, Section 4.2 - Information and Notification Process at 13 (notifications were published by FCC public notice and posted on the Oregon Chapter APCO website at http://www.oregonapconena.org. Region 35 maintains a website at http://www.region-35.org for all meeting agendas, minutes and key resource documents. See Plan, Appendix B - By-Laws of Region 35. See Plan, Appendix C - Region 35 Membership; see also Appendix
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2034A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2034A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2034A1.txt
  • PG&E will file identical waiver requests with respect to other existing stations the licenses for which PG&E has acquired by assignment. PG&E also anticipates filing additional applications for new 90 trunked Industrial/Business Pool stations, or for modification of existing licenses, for which it also will request a June 30, 2013 construction deadline. PG&E serves approximately 5.1 million electricity customers and 4.2 million natural gas customers across northern and central California. PG&E states that it plans to replace various existing radio systems with a single, integrated system that maximizes efficiency through trunking and frequency re-use, and provides functionality not available in PG&E's legacy systems. The new integrated trunked radio network will consist of over one hundred repeater sites, and thousands of mobile
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2034A1_Rcd.pdf
  • (Station WPPB889), 0004338881 (Station WPUA857). 4See File No. 0004411788 (Station WNGE426). 5See File No. 0004316546 (Station WPVE245). 647 C.F.R. § 20.9(a). 7SeeAppendix A for a list of the call signs at issue. 14606 Pool stations, or for modification of existing licenses, for which it also will request a June 30, 2013 construction deadline. PG&E serves approximately 5.1 million electricity customers and4.2 million natural gas customers across northern and central California. PG&E states that it plans to replace various existing radio systems with a single, integrated system that maximizes efficiency through trunking and frequency re-use, and provides functionality not available in PG&E's legacy systems. The new integrated trunked radio network will consist of over one hundred repeater sites, and thousands of mobile
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-220A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-220A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-220A1.txt
  • the People of the State of California for Rulemaking on States' Access to the Network Outage Reporting System (NORS) Database and a Ruling Granting California Access to NORS, ET Docket No. 04-35 (Nov. 12, 2009) (CPUC Petition). 47 C.F.R. § 1.401. See CPUC Petition. 47 C.F.R. § 1.41. CPUC Petition at 1, 13-20. 47 C.F.R. Part 4. 47 C.F.R. § 4.2. New Part 4 of the Commission's Rules Concerning Disruptions to Communications, Report and Order and Further Notice of Proposed Rulemaking, ET Docket No. 04-35, 19 FCC Rcd 16830, 16856, ¶ 47 (2004) (Part 4 Report and Order). See CPUC Petition at 3-4; see also Part 4 Report and Order, 19 FCC Rcd at 16848, ¶ 32 (emphasis added). CPUC Petition
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2342A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2342A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2342A1.txt
  • operational functions by at least fifty users. Waiver Order at ¶ 47. See Alcatel-Lucent Ex Parte Filing, PS Docket 06-229 at 3 (filed Aug. 18, 2010) (``Public Safety Broadband Interoperability Recommendations: FCC Interoperability Vendor Meeting''). See, e.g., 3rd Generation Partnership Project; Technical Specification Group Services and System Aspects; Network Sharing; Architecture and functional description (Release 9), 3GPP TS 23.251 at 4.2.1 (2009). . See Public Safety and Homeland Security Bureau Seeks Comment on Interoperability, Out of Band Emissions and Equipment Certification for 700 MHz Public Safety Broadband Networks, PS Docket 06-229, Public Notice, 25 FCC Rcd 5486 (PSHSB 2010) (Technical Public Notice). See id. at 5487; see also NPSTC BBTF Report at 6.3.1. See Technical Public Notice at 5487-88. See Alcatel-Lucent
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.txt
  • \rtlch\fcs1 \af0\afs24\alang1025 \ltrch\fcs0 \fs24\lang1033\langfe1033\cgrid\langnp1033\langfenp1033 {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4.1 Requirements\tab }{\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof SEQ SectionNumber _Toc280004971 \\* ARABIC }}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof -} {\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof PAGEREF _Toc280004971 \\h }{\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof {\*\datafield 08d0c9ea79f9bace118c8200aa004ba90b02000000080000000e0000005f0054006f0063 003200380030003000300034003900370031000000}}}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 1}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof \par 4.2 Functional Specifications\tab }{\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof SEQ SectionNumber _Toc280004972 \\* ARABIC }}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof -}{\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof PAGEREF _Toc280004972 \\h }{\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof {\*\datafield 08d0c9ea79f9bace118c8200aa004ba90b02000000080000000e0000005f0054006f0063 003200380030003000300034003900370032000000}} }{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 1}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof \par }\pard\plain \ltrpar\s33\ql \li677\ri0\widctlpar\tqr\tldot\tx8976\wrapdefault\aspalpha\aspnum\faauto \adjustright\rin0\lin677\itap0 \rtlch\fcs1 \af0\afs24\alang1025 \ltrch\fcs0 \fs24\lang1033\langfe1033\cgrid\langnp1033\langfenp1033
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2.txt
  • due diligence procedure contained in Annex 1 to this Resolution shall be applied as from 22 November 1997 for a satellite network or satellite system of the fixed- satellite service, mobile-satellite service or broadcasting-satellite service for which the advance publication information under No. 9.2B, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 b) of Appendices 30 and 30A that involve the addition of new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2_Rcd.pdf
  • due diligence procedure contained in Annex 1 to this Resolution shall be applied as from 22 November 1997 for a satellite network or satellite system of the fixed- satellite service, mobile-satellite service or broadcasting-satellite service for which the advance publication information under No. 9.2B, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 b) of Appendices 30 and 30A that involve the addition of new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-407A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-407A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-407A1.txt
  • The condition provided that: Any operations of EchoStar-86.5W shall be conducted in a manner that does not exceed the interference limits in Annex 1 to Appendices 30 and 30A of the ITU Radio Regulations within the service areas of any affected operators. Upon a showing to the Commission of successful coordination with any such affected operator (pursuant to the Article 4.2 of Appendices 30 and 30A of the Radio Regulations), EchoStar may operate in a manner consistent with such coordination. Spectrum Five argues that it is an ``affected operator'' and, therefore, DISH should be prevented from operating with parameters in excess of those specified in the Region 2 BSS Plans until coordination is completed, as was the case in the EchoStar-86.5W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-407A1_Rcd.pdf
  • plan modification proposal (to the extent the EchoStar 8 proposal has ITU date of receipt priority with respect to the space station network brought into use)." Spectrum Five LLC, Petition for Clarification of Condition in EchoStar 11 License, Order, 23 FCC Rcd 12786, 12788-89 (Int'l Bur. 2008). 23The modification procedures for the Region 2 BSS Plans are stipulated in Section 4.2 of Article 4 ofAppendices 30 and 30A of the ITU Radio Regulations. 24Annex 1 of Appendices 30 and 30A provide the methodology and criteria to be used for determining whether a proposed DBS system may cause interference to other systems. 25DIRECTV Enterprises, Order and Authorization, 21 FCC Rcd 8028 (Sat. Div., Int'l Bur. 2006); 47 C.F.R. § 25.111(a). 2314 Federal
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1252A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1252A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1252A1.txt
  • ITU Radio Regulations, and the associated Plan for feeder links in the 17.3-17.8 GHz band for the BSS in Region 2, as contained in Appendix 30A of the ITU Radio Regulations. If an Administration seeks to operate at variance from the Region 2 BSS Plan, it must effectuate a modification to the Plan pursuant to ITU procedures, stipulated in Section 4.2 of Article 4 of Appendices 30 and 30A of the ITU Radio Regulations. Market Access Grant, 21 FCC Rcd at 14036, ¶ 28. Both DIRECTV and EchoStar operate in-orbit DBS satellites at the planned orbital locations (110º W.L. and 119º W.L.) on either side of Spectrum Five's location. Id. at 14037, ¶ 30. Id. at 14037, ¶ 31 and 14042-43,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1252A1_Rcd.pdf
  • ITU Radio Regulations, and the associated Plan for feeder links in the 17.3-17.8 GHz band for the BSS in Region 2, as contained in Appendix 30A of the ITU Radio Regulations. If an Administration seeks to operate at variance from the Region 2 BSS Plan, it must effectuate a modification to the Plan pursuant to ITU procedures, stipulated in Section 4.2 of Article 4 of Appendices 30 and 30A of the ITU Radio Regulations. 6Market Access Grant, 21 FCC Rcd at 14036, ¶ 28. Both DIRECTV and EchoStar operate in-orbit DBS satellites at the planned orbital locations (110º W.L. and 119º W.L.) on either side of Spectrum Five's location. 7Id. at 14037, ¶ 30. 8Id.at 14037, ¶ 31 and 14042-43, ¶
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1455A2_Rcd.pdf
  • Do Not Change the Categorical Exclusion ............................................................................ 3-7 3.4 Alternatives Considered And Dismissed ............................................................ 3-9 3.4.1 Prohibit All New Tower Construction ................................................... 3-9 3.4.2 Prohibit Towers That Exceed a Certain Height ..................................... 3-9 3.4.3 Prohibit Towers in Certain Locations .................................................... 3-9 3.4.4 Prohibit Guy Wires on New Towers .................................................... 3-10 CHAPTER FOUR AFFECTED ENVIRONMENT .................................................................................... 4-1 4.1 Introduction ......................................................................................................... 4-1 4.2 Existing Communications Towers ...................................................................... 4-1 4.2.1 General Characteristics .......................................................................... 4-1 4.2.2 Number of Existing Towers ................................................................... 4-2 4.2.3 Distribution of Existing Towers ............................................................ 4-3 4.2.4 Future Needs/Trends .............................................................................. 4-3 4.3 Resources Not Affected ...................................................................................... 4-4 4.3.1 Geology.................................................................................................. 4-4 4.3.2 Soils ....................................................................................................... 4-4 4.3.3 Farmlands .............................................................................................. 4-4 13849 Table of Contents ii 4.3.4 Groundwater .......................................................................................... 4-5 4.3.5 Coastal Zones/Coastal Barriers ..............................................................
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1643A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1643A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1643A1.txt
  • trans-Atlantic submarine cables landing in the United States. The two submarine cables owned and operated by the Applicants accounted for 3.6 Tbps, or approximately 28% of that capacity. We project that with new technology and upgrades to the submarine cables, in 2012 there will be approximately 16.7 Tbps capacity on these trans-Atlantic cables and that the Applicants will account for 4.2 Tbps of that or approximately 24.9%. Given that over 70% of the available capacity is owned and controlled by entities unaffiliated with the Applicants, the anticipated decrease in the Applicants' share of the available capacity, the low barriers to entry, and the substantial amount of transport capacity available now and upgradable with new technology, we find that the merger does
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-284A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-284A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-284A1.txt
  • a contributing factor, because the new findings occurred mostly in communities in which incumbent operators charged relatively high prices for expanded basic service. But the differential also reflects that, in contrast to past surveys, expanded basic prices are growing faster in effective competition communities than in noncompetitive communities. Overall, on a per channel basis, the average price per channel was 4.2 percent lower, reflecting the fact that the effective competition communities, on average, carry more channels on expanded basic than the noncompetitive group. Table 1 Monthly Prices January 1, 2009 Date Overall Weighted Average Non-Competitive Subgroups of Effective Competition Communities Weighted Average Second Cable Operator DBS Wire-less MVPD LP Test Weighted Average Incumbent Rival Basic Service 1/1/2009 $17.65 $17.88 $17.16 $16.05
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-297A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-297A2.txt
  • plus or minus $1.4 million. Since only one completed audit in the sample resulted in the full disbursement being designated as improper, this worst case scenario appears very unlikely. In conclusion, for now it is best to rely on the two alternatives in Method I. We can be highly confident that the true improper payment rate was between 2.1 and 4.2 percent. 1 This is equivalent to `ignoring the non-respondents (incomplete audits).' 2 This is equivalent to post-stratifying the sample by whether or not the audit was reconciled, and assuming a worst-case 100% improper payment rate among the incompletes. APPENDIX A 2 Method I: Final Second Round Results for High Cost: FY2007 This table excludes the eight incomplete audits from the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-324A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-324A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-324A1.txt
  • and 0.283, IT IS ORDERED That, effective April 4, 2011, the FM Table of Allotments, 47 C.F.R. Section 73.202(b), IS AMENDED, with respect to the community listed below, to read as follows: Community Channel Willow Creek, California 258A The reference coordinates for FM Channel 258A at Willow Creek, California, are 40-57-29 NL and 123-42-23 WL, at a site 6.7 km (4.2 miles) west of the community. 6. IT IS FURTHER ORDERED, That the Form 301 application filed by Miriam Media, Inc., for FM Channel 254C1 at Loleta, California, File No. BNPH-20070406ABY, IS GRANTED. 7. IT IS FURTHER ORDERED, That the Secretary of the Commission shall send by Certified Mail, Return Receipt Requested, a copy of this Order to the following counsel
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-438A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-438A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-438A1.txt
  • 90 I/B Pool stations and a Part 22 VHF/UHF Paging (``Part 22 Paging'') station, the licenses for which PG&E acquired by assignment. If the instant requests are granted, PG&E intends to file identical requests with respect to other new and existing stations. For the reasons stated below, we grant the requests. Background. PG&E serves approximately 5.1 million electricity customers and 4.2 million natural gas customers (representing approximately 15 million people) throughout more than 74,000 square miles across northern and central California. PG&E's various lines of business (i.e., Gas & Electric Distribution, Gas & Electric Transmission, Hydro Generation, Customer Care and General Services) currently use separate radio systems in different frequency bands. PG&E states that the systems are in need of replacement,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-438A1_Rcd.pdf
  • of existing Part 90 I/B Pool stations3and a Part 22 VHF/UHF Paging ("Part 22 Paging") station,4the licenses for which PG&E acquired by assignment.5If the instant requests are granted, PG&E intends to file identical requests with respect to other new and existing stations.6For the reasons stated below, we grant the requests.7 2. Background. PG&E serves approximately 5.1 million electricity customers and 4.2 million natural gas customers (representing approximately 15 million people) throughout more than 74,000 square miles across northern and central California.8PG&E's various lines of business (i.e., Gas & Electric Distribution, Gas & Electric Transmission, Hydro Generation, Customer Care and General 1Comment was sought on the requests. SeeWireless Telecommunications Bureau Seeks Comment on Request by Pacific Gas & Electric Company for Waivers
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.txt
  • NANC's Local Number Portability Administration Selection Working Group, dated April 25, 1997 (Working Group Report) and its appendices, which are incorporated by reference pursuant to 5 U.S.C. 552(a) and 1 CFR part 51.''). Second Report and Order, 12 FCC Rcd 12281, 12299 ¶¶ 26-27. Second Report and Order, 12 FCC Rcd at 12301 ¶ 30 (citing Working Group Report, § 4.2.3). Id. Id. at 12299-300 ¶ 28; Working Group Report, §§ 2.5.2, 2.5.3. Telecommunications Act of 1996, Public L. No. 104-104, 110 Stat. 56, codified at 47 U.S.C. §§ 151 et seq. Second Report and Order, 12 FCC Rcd at 12301 ¶ 29; Working Group Report, § 4.1.1. Second Report and Order, 12 FCC Rcd at 12303 ¶ 33. Section 6.4.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2.txt
  • administrative due diligence procedure contained in Annex 1 to this Resolution shall be applied as from 22 November 1997 for a satellite network or satellite system of the fixed-satellite service, mobile-satellite service or broadcasting-satellite service for which the advance publication information under No. 9.2B, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 b) of Appendices 30 and 30A that involve the addition of new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2_Rcd.pdf
  • administrative due diligence procedure contained in Annex 1 to this Resolution shall be applied as from 22 November 1997 for a satellite network or satellite system of the fixed-satellite service, mobile-satellite service or broadcasting-satellite service for which the advance publication information under No. 9.2B, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 b) of Appendices 30 and 30A that involve the addition of new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.txt
  • one public broadcaster. The large number of radio and television stations furnishes the public with a wide array of choices. Satellite and cable entities provide access to popular international media. Topography: Japan occupies an area slightly smaller than California. The terrain is mostly rugged and mountainous. Fixed Total Fiber Cable DSL Other Fixed broadband subs per 100 inhabitants 26.3 14.6 4.2 7.3 0.2 Fixed broadband subs (June 2010) 33,550,555 % of households with fixed broadband access (2009) 65.2 Mobile Mobile wireless broadband subs per 100 inhabitants 75.3 Mobile wireless broadband subs (June 2010) 96,115,074 21. Korea Regulation: The Korea Communications Commission (KCC) was created in February 2008 when the government combined the Ministry of Information and Communication (MIC) and Korean Broadcasting
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1_Rcd.pdf
  • price data for OECD countriesis also part of the proposal.These and other coordinated improvements in broadband data gathering would facilitate more rigorous empirical analyses. IV. CONCLUSION 52.In conjunction with the Commission's adoption of the Seventh 706 Report, the release of this IBDRfulfills the obligation imposed by Section 103(b) of the Broadband Data Improvement Act.116 113See, e.g., National Broadband Plan, Recommendations 4.2-4.4. (2010), available at http://download.broadband.gov/plan/national-broadband-plan.pdf. 114SeeModernizing the FCC Form 477 Data Program, WC Docket No. 11-10, Notice of Proposed Rulemaking, FCC 11-14 (rel. Feb. 8, 2011). 115The concept of urbanicity refers to the degree to which a geographical unit is urban. See http://www.urbanicity.us/Urbanicity.html. 11647 U.S.C. § 1303(b). 7395 Federal Communications Commission DA 11-732 V. ORDERING CLAUSE 53.ITIS ORDERED that, pursuant to
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-79A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-79A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-79A1.txt
  • service calls, system repair and maintenance, and other administrative problems related to illegal connections result in significant financial outlay. Further, in a supplement to its petition, OneLink states that it conducted an audit from November 8-13, 2010 in the six worst neighborhoods of its system in terms of damaged facilities. After conducting this audit of an area that comprises just 4.2 percent of homes passed on its system, OneLink found that the illegal connections in these six neighborhoods represented an overall cable theft rate of 30.6 percent. OneLink argues that the November audit proves, if nothing else, that there is a continuing and very serious problem with theft in multiple parts of the system warranting a waiver of the prohibition on
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-2A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-2A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-2A1.txt
  • LPFM stations, at 1.3 percent. It is evident that the format specialization of full-service stations is greater because only a small number of such stations carry the format category of ``miscellaneous'' - only 5.1 percent of all full-service stations and 1.4 percent of full-service commercial FM stations fall into this category, compared to 33 percent of LPFM stations. Similarly, only 4.2 percent of full-service stations and 1.0 percent of full-service commercial FM stations have the specific format of ``variety,'' compared to 28.2 percent of LPFM stations. BIA reports that 87 percent of all full-service stations and 89 percent of full-service commercial FM stations have their own websites, percentages that are roughly twice as high as that for LPFM stations. Full-service stations
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.txt
  • Group Second Cable Operator DBS Other Incumbent Rival Both Analog & SD digital 13.6 12.1 16.7 15.0 15.4 15.0 17.2 17.5 HD digital versions 3.8 3.6 4.1 3.8 6.4 4.3 4.1 3.6 Multicast channels 6.6 5.5 9.0 9.9 8.1 9.6 8.9 8.4 Total local broadcast 24.0 21.1 29.8 28.7 29.9 28.9 30.2 29.5 PEG 3.6 3.4 4.1 4.0 5.9 4.3 4.2 2.6 Leased access 1.1 1.0 1.2 1.7 0.6 1.5 1.2 0.8 Regional sports 0.2 0.2 0.3 0.5 0.2 0.5 0.2 0.3 Other 12.0 11.6 12.7 15.0 6.3 13.5 12.6 10.5 Total 41.0 37.4 48.1 49.9 42.9 48.7 48.5 43.6 Source: Survey. Table 6 reports the number of regional sports networks (RSNs) included in service offerings. Overall, the average is 0.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.txt
  • contract end. Maintenance Plan The contractor shall furnish a Maintenance Plan within 150 calendar days of contract award per Section 3.6. REQUIRED PERFORMANCE METRICS REQUIRED PERFORMANCE METRICS (RPM) TABLE Required Service Performance Standards Acceptable Quality Levels Method Of Surveillance Incentive (Negative) (Impact on Contractor Payments) Process Applications (See PWS 2.20.4,2.22.4.6) Answer calls (See PWS 2.22.4.3) Submission of Deliverables (See PWS 4.2, 4.3, 4.4, 4.5, 4.6, 4.6.1, 4.6.2.1, 4.6.2.2, 4.6.3.1, 4.7, 4.8, 4.9, 4.10) Submission of Deliverables (See PWS 4.6.4.1, 4.6.4.2, 4.6.4.3, 4.6.5, ) PAS Availability (See PWS 3.3) Maintenance (See PWS 3.3) Maintenance (See PWS 3.3) Applications processed within 7 calendar days Calls answered within 1 business day Deliverables submitted no later than the due dates Deliverables submitted no later than
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.txt
  • made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and to protect the DoJ's and the FBI's interests. 4.2 Inspections. Upon reasonable notice and during reasonable hours, the DoJ and the FBI may visit any telecommunications facility of TMI in the United States, and may inspect any part of said TMI facility for the purpose of verifying compliance with the terms of this Agreement and the Implementation Plan. 4.3 Interviews. Upon reasonable notice from the DoJ or the FBI,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-185275A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-185275A1.txt
  • LOS ANGELES 01/14/2000 19035.00000 34-03-11.0 N FL NE 082-26-48.0 W 0000067931 City of Tampa, Electronics TAMPA 01/10/2000 23475.00000 27-58-43.0 N FL NE 082-27-38.8 W 0000067954 City of Tampa, Electronics Tampa 01/10/2000 23425.00000 27-57-31.7 N IN NE 086-09-53.0 W 0000068407 Indiana Department of Transportation Indianapolis 01/11/2000 23375.00000 39-46-08.2 N IN NE 086-09-13.0 W 0000068408 Indiana Department of Transportation Indianapolis 01/11/2000 23425.00000 39-46-04.2 N TX NE 097-40-22.0 W 0000069193 Round Rock, City of ROUND ROCK 12/30/1999 06648.75000 30-31-04.7 N KY RM WEE402 082-37-11.5 W 0000068515 KENTUCKY, COMMONWEALTH OF ASHLAND 01/11/2000 02194.40000 38-27-43.2 N KY RM WEE402 082-37-11.5 W 0000068515 KENTUCKY, COMMONWEALTH OF ASHLAND 01/11/2000 06815.00000 38-27-43.2 N TX RM WNTX470 098-08-51.0 W 0000069517 Lower Colorado River Authority MARION 01/14/2000 00956.31875 29-37-14.8 N TX
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202342A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202342A1.txt
  • N IN NE 086-09-52.9 W 0000117259 PSI ENERGY, INC. WESTFIELD 04/26/2000 06650.00000 40-02-47.1 N AR NE P 094-28-58.0 W 0000117267 CITY OF GENTRY GENTRY 04/24/2000 00956.38125 36-16-00.0 N TX NE 101-57-37.7 W 0000117299 Colorado Interstate Gas Company, Inc. AMARILLO 04/26/2000 00932.36875 35-38-30.2 N TX NE 101-57-37.7 W 0000117299 Colorado Interstate Gas Company, Inc. AMARILLO 04/26/2000 00941.36875 35-38-30.2 N IN NE 086-10-04.2 W 0000117304 PSI ENERGY, INC. Sheridan 04/26/2000 06810.00000 40-05-45.7 N CO NE 104-43-03.9 W 0000117311 Colorado Interstate Gas Company, Inc. Denver 04/26/2000 00928.13125 39-36-10.9 N CO NE 104-43-03.9 W 0000117311 Colorado Interstate Gas Company, Inc. Denver 04/26/2000 00952.13125 39-36-10.9 N WY NE 105-17-30.9 W 0000117320 Colorado Interstate Gas Company, Inc. Douglas 04/26/2000 00928.01875 42-43-09.9 N Page 25 MG - Microwave
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202481A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202481A1.txt
  • Number Frequency (MHz) Applicant Name Latitude City IA NE 090-31-04.5 W 0000097626 IOWA AMERICAN WATER CO BETTENDORF 03/16/2000 00952.71875 41-33-39.1 N IA NE 090-35-24.5 W 0000097639 IOWA AMERICAN WATER CO DAVENPORT 03/16/2000 00928.74375 41-34-52.1 N IA NE 090-35-24.5 W 0000097639 IOWA AMERICAN WATER CO DAVENPORT 03/16/2000 00952.74375 41-34-52.1 N OH NE 081-41-39.5 W 0000101460 WJW LICENSE INC CLEVELAND 03/07/2000 18590.00000 41-30-04.2 N CA NE 115-30-10.9 W 0000118871 Frontcom.com Inc. Calexico 05/01/2000 22466.50000 32-40-11.2 N IA NE 095-04-31.0 W 0000118925 Northwest Iowa Power Cooperative Manning 05/01/2000 00928.64375 41-54-45.0 N IA NE 095-04-31.0 W 0000118925 Northwest Iowa Power Cooperative Manning 05/01/2000 00952.64375 41-54-45.0 N TX NE 102-10-13.5 W 0000119024 ARCO COMMUNICATIONS INC CRANE 05/01/2000 00932.31875 31-24-26.5 N TX NE 102-10-13.5 W 0000119024 ARCO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202671A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202671A1.txt
  • 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18000.00000 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18040.00000 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18080.00000 39-46-08.1 N IN NE 086-07-41.8 W 0000126032 KATLINK LLC Indianapolis 05/09/2000 19360.00000 39-45-56.0 N IN NE 086-09-31.2 W 0000126033 KATLINK LLC Indianapolis 05/09/2000 19560.00000 39-46-04.2 N IN NE 086-09-40.5 W 0000126034 KATLINK LLC Indianapolis 05/09/2000 19520.00000 39-45-49.4 N IN NE 086-09-32.5 W 0000126035 KATLINK LLC Indianapolis 05/09/2000 19400.00000 39-45-49.9 N IN NE 086-09-22.7 W 0000126036 KATLINK LLC Indianapolis 05/09/2000 19640.00000 39-45-57.0 N IN NE 086-09-25.3 W 0000126037 KATLINK LLC Indianapolis 05/09/2000 19600.00000 39-46-05.6 N IN NE 086-09-28.3 W 0000126038 KATLINK LLC Indianapolis 05/09/2000 19440.00000 39-46-02.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203279A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203279A1.txt
  • 06/07/2000 19560.00000 42-21-30.6 N Page 21 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA NE 071-03-30.1 W 0000158706 Teligent License Company II, L.L.C. Boston 06/07/2000 19640.00000 42-21-30.6 N MA NE 071-04-21.1 W 0000158707 Teligent License Company II, L.L.C. Boston 06/07/2000 18080.00000 42-21-04.2 N MA NE 071-03-28.1 W 0000158708 Teligent License Company II, L.L.C. Charlestown 06/07/2000 18000.00000 42-22-16.6 N IN NE 086-09-28.3 W 0000158709 Teligent License Company II, L.L.C. Indianapolis 06/07/2000 17880.00000 39-47-27.4 N CT NE 072-48-39.8 W 0000158710 Teligent License Company II, L.L.C. FARMINGTON 06/07/2000 18040.00000 41-42-41.6 N CA NE 118-27-15.1 W 0000158781 Southern California Edison Company Tehachapi 06/07/2000 10667.50000 35-08-09.0 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203818A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203818A1.txt
  • N CA AM WLT563 117-20-48.2 W 0000167186 LOS ANGELES SMSA LIMITED PARTNERSHIP COLTON 06/28/2000 18040.00000 34-02-15.0 N CA AM WLT563 117-20-48.2 W 0000167186 LOS ANGELES SMSA LIMITED PARTNERSHIP COLTON 06/28/2000 18797.50000 34-02-15.0 N CA AM WLT563 117-20-48.2 W 0000167186 LOS ANGELES SMSA LIMITED PARTNERSHIP COLTON 06/28/2000 18817.50000 34-02-15.0 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/30/2000 17840.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/30/2000 17920.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/30/2000 17960.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/30/2000 18040.00000 34-03-04.2 N MO AM WPQN490 090-11-33.1 W 0000175052 KATLINK LLC ST. LOUIS 06/27/2000 17800.00000 38-37-42.2 N MO AM WPQN490 090-11-33.1 W 0000175052
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203907A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203907A1.txt
  • W 0000168682 BACKLINK LLC OAKLAND 06/19/2000 19400.00000 37-48-12.0 N CA NE 122-16-22.0 W 0000168683 BACKLINK LLC OAKLAND 06/19/2000 17840.00000 37-48-13.7 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/19/2000 17840.00000 34-03-04.2 N CA NE 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/19/2000 17920.00000 34-03-04.2 N CA NE 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 06/19/2000 17960.00000 34-03-04.2 N CA NE 118-15-46.3 W 0000168693 BACKLINK LLC LOS ANGELES 06/19/2000 19480.00000 34-03-17.2 N CA NE 118-15-50.5 W 0000168694 BACKLINK LLC LOS ANGELES 06/19/2000 19400.00000 34-03-10.0 N CA NE 118-17-04.2 W 0000168695 BACKLINK LLC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204064A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204064A1.txt
  • City LA NE 089-31-56.2 W 0000187671 Bellsouth Telecommunications, Inc. BURAS 07/13/2000 19480.00000 29-21-20.7 N HI NE 157-49-25.0 W 0000187755 HighSpeed.Com, L.L.C. Honolulu 07/13/2000 23225.00000 21-17-13.0 N HI NE 157-51-37.9 W 0000187756 HighSpeed.Com, L.L.C. Honolulu 07/13/2000 22025.00000 21-18-36.0 N GA NE 084-22-38.6 W 0000187975 BACKLINK LLC ATLANTA 07/13/2000 18080.00000 33-51-05.4 N GA NE 084-22-36.0 W 0000187976 BACKLINK LLC ATLANTA 07/13/2000 18120.00000 33-51-04.2 N CA NE 118-14-52.5 W 0000187978 BACKLINK LLC LOS ANGELES 07/13/2000 19640.00000 34-02-56.4 N CA NE 118-15-16.3 W 0000187979 BACKLINK LLC LOS ANGELES 07/13/2000 19680.00000 34-02-55.5 N WA NE 122-20-05.0 W 0000187981 BACKLINK LLC SEATTLE 07/13/2000 19680.00000 47-36-02.3 N WA NE 122-20-07.4 W 0000187982 BACKLINK LLC SEATTLE 07/13/2000 19560.00000 47-34-51.2 N WA NE 122-20-02.1 W 0000187983 BACKLINK LLC SEATTLE 07/13/2000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204615A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204615A1.txt
  • W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19520.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19560.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19600.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 22625.00000 37-31-49.5 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17840.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17920.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17960.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 18040.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 22675.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205050A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205050A1.txt
  • CA NE 118-07-55.2 W 0000201564 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 06063.80000 34-08-42.0 N CA NE 118-24-59.2 W 0000201568 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 18120.00000 34-03-37.0 N CA NE 118-27-07.2 W 0000201578 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 19680.00000 34-02-00.0 N CA NE 117-08-11.2 W 0000201579 BACKLINK LLC San Diego 08/07/2000 17800.00000 32-46-08.7 N CA NE 117-08-04.2 W 0000201580 BACKLINK LLC San Diego 08/07/2000 18040.00000 32-46-10.6 N CA NE 117-08-07.0 W 0000201581 BACKLINK LLC San Diego 08/07/2000 17920.00000 32-46-09.2 N CA NE 117-09-39.8 W 0000201582 BACKLINK LLC San Diego 08/07/2000 17840.00000 32-45-44.0 N CA NE 117-09-33.1 W 0000201583 BACKLINK LLC San Diego 08/07/2000 17920.00000 32-46-23.7 N PA NE 075-28-16.6 W 0000201587 BACKLINK LLC BERWYN 08/07/2000 17880.00000 40-03-49.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205248A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205248A1.txt
  • SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10632.50000 42-31-49.0 N MA AM WPNE680 071-08-14.0 W 0000108957 SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10647.50000 42-31-49.0 N MA AM WPNE680 071-08-14.0 W 0000108957 SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10667.50000 42-31-49.0 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 02165.20000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 02171.60000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 06226.89000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 06286.19000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205412A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205412A1.txt
  • 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22675.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22725.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22825.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22975.00000 32-43-27.6 N CA AM 117-11-04.2 W 0000167140 BACKLINK LLC SAN DIEGO 08/23/2000 19600.00000 32-44-30.9 N DC AM WPOU557 077-02-03.3 W 0000167148 BACKLINK LLC WASHINGTON 08/24/2000 22475.00000 38-54-02.7 N DC AM WPOU557 077-02-03.3 W 0000167148 BACKLINK LLC WASHINGTON 08/24/2000 22875.00000 38-54-02.7 N CA AM 117-07-53.8 W 0000182460 Teligent License Company II, L.L.C. SAN DIEGO 08/21/2000 17800.00000 32-53-39.4 N Page 8 CF - Common Carrier Fixed Point
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205600A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205600A1.txt
  • FL MD WPOR205 082-58-49.8 W 0000211768 FLORIDA RSA #8, INC. OLD TOWN 08/29/2000 02124.80000 29-36-41.4 N FL MD WPOR205 082-58-49.8 W 0000211768 FLORIDA RSA #8, INC. OLD TOWN 08/29/2000 02128.00000 29-36-41.4 N PA MD WPJA752 078-07-58.0 W 0000211775 PENNSYLVANIA CELLULAR TELEPHONE CORP HUNTINGDON 08/29/2000 06197.24000 40-29-52.2 N PA MD WPNE970 078-25-02.0 W 0000211780 PENNSYLVANIA CELLULAR TELEPHONE CORP HOLLIDAYSBURG 08/29/2000 05945.20000 40-27-04.2 N IL MD WPQP767 087-52-15.0 W 0000211789 BACKLINK LLC Deerfield 08/29/2000 17800.00000 42-09-08.0 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPQP767 087-52-15.0 W 0000211789 BACKLINK LLC Deerfield 08/29/2000 17840.00000 42-09-08.0 N IL MD WPQP767 087-52-15.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205915A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205915A1.txt
  • WMS414 117-12-13.1 W 0000217426 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 19405.00000 32-52-27.2 N CA MD WMS936 117-10-56.1 W 0000217430 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 19525.00000 32-51-08.2 N CA MD WMT761 117-05-50.1 W 0000217432 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 10628.12500 32-43-18.2 N CA MD WLT476 117-01-23.1 W 0000217438 Verizon Wireless (VAW) LLC CHULA VISTA 09/12/2000 10637.50000 32-37-04.2 N CA MD WPOL964 118-15-20.1 W 0000217448 BACKLINK, L.L.C. Los Angeles 09/12/2000 19600.00000 34-02-52.6 N CA MD WPOL964 118-15-20.1 W 0000217448 BACKLINK, L.L.C. Los Angeles 09/12/2000 19680.00000 34-02-52.6 N CA MD WPOL966 118-15-29.3 W 0000217449 BACKLINK, L.L.C. Los Angeles 09/12/2000 18040.00000 34-02-56.7 N CA MD WPOL965 118-15-28.7 W 0000217450 BACKLINK, L.L.C. Los Angeles 09/12/2000 18120.00000 34-03-00.4 N CA MD WLM873
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206274A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206274A1.txt
  • WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21375.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21475.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21575.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21675.00000 42-20-00.6 N MI AM 083-02-35.2 W 0000165270 BACKLINK LLC DETROIT 09/25/2000 18080.00000 42-20-04.2 N Page 4 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI AM 083-02-35.2 W 0000165270 BACKLINK LLC DETROIT 09/25/2000 18080.00000 42-20-04.2 N IL AM 087-58-57.4 W 0000168734 BACKLINK LLC ARLINGTON HTS. 09/27/2000 10755.00000 42-08-14.2 N IL AM 087-58-57.4 W 0000168734 BACKLINK
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206369A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206369A1.txt
  • 10/03/2000 00947.00000 33-42-23.8 N SC AM WBB436 078-53-24.6 W 0000182908 NextMedia Licensing, Inc. MYRTLE BEACH 10/03/2000 00948.85000 33-42-23.8 N SC AM WBB436 078-53-24.6 W 0000182908 NextMedia Licensing, Inc. MYRTLE BEACH 10/03/2000 00948.85000 33-42-23.8 N CT MD WAY672 073-04-35.0 W 0000234151 CXR HOLDINGS INC Milford 10/05/2000 00951.00000 41-14-46.0 N OH MD WLI647 081-40-46.5 W 0000234183 Infinity Radio Inc. Cleveland 10/05/2000 00945.50000 41-30-04.2 N Page 1 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VT MD WPOT844 072-30-49.7 W 0000234637 Bulmer Communications of Vermont, Inc.Barre 10/06/2000 00951.50000 44-11-39.6 N CA MD WPNM783 119-47-45.0 W 0000234756 Illinois Lotus Corp. Fresno 10/06/2000 00947.50000 36-45-26.0 N CA MD WPNM783 119-47-45.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206584A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206584A1.txt
  • STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 05945.20000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06345.49000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06775.00000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06855.00000 42-04-13.0 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 01865.00000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 01875.00000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 02142.80000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206940A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206940A1.txt
  • 10/23/2000 06315.84000 36-08-37.9 N NV NE 115-05-00.0 W 0000243952 CNG COMMUNICATIONS, INC. HENDERSON 10/23/2000 06345.49000 36-08-37.9 N NV NE 115-05-00.0 W 0000243952 CNG COMMUNICATIONS, INC. HENDERSON 10/23/2000 06375.14000 36-08-37.9 N NV NE 115-05-00.0 W 0000243952 CNG COMMUNICATIONS, INC. HENDERSON 10/23/2000 06404.79000 36-08-37.9 N IL NE 088-02-05.4 W 0000243957 Teligent License Company II, L.L.C. Schaumburg 10/23/2000 19480.00000 42-03-44.8 N IL NE 088-02-04.2 W 0000243958 Teligent License Company II, L.L.C. Schaumburg 10/23/2000 19400.00000 42-03-46.2 N IL NE 088-02-05.6 W 0000243959 Teligent License Company II, L.L.C. Schaumburg 10/23/2000 19600.00000 42-03-46.8 N CA NE 121-55-24.1 W 0000244020 Bay Area Cellular Telephone Company SAN RAMON 10/23/2000 10648.12500 37-44-56.6 N PA NE 075-39-17.8 W 0000244021 KATLINK LLC Exton 10/23/2000 18000.00000 40-03-43.3 N Page 16 CF - Common
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207245A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207245A1.txt
  • 38-21-30.0 N CO RM WPIH528 106-21-32.1 W 0000249786 PAGING NETWORK OF COLORADO INCVAIL 09/13/2000 00929.28750 39-36-19.9 N CO RM WPIH528 106-21-32.1 W 0000249786 PAGING NETWORK OF COLORADO INCVAIL 09/13/2000 00929.58750 39-36-19.9 N CO RM WPIH528 106-21-32.1 W 0000249786 PAGING NETWORK OF COLORADO INCVAIL 09/13/2000 00929.86250 39-36-19.9 N TN RM WPFK258 086-28-37.0 W 0000249787 PAGING NETWORK OF AMERICA INCGALLATIN 09/13/2000 00929.91250 36-28-04.2 N TN RM WPFK258 083-40-05.6 W 0000249787 PAGING NETWORK OF AMERICA INCSEVIERVILLE 09/13/2000 00929.91250 35-48-42.3 N Page 66 GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MS RM WPFK258 089-57-34.3 W 0000249787 PAGING NETWORK OF AMERICA INCSOUTHAVEN 09/13/2000 00929.91250 34-56-35.3 N TN RM WPFK258
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207434A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207434A1.txt
  • 0000253274 PAGING NETWORK OF AMERICA INCCORAOPOLIS 09/18/2000 00929.73750 40-30-32.2 N PA RM WPIH485 080-06-02.2 W 0000253274 PAGING NETWORK OF AMERICA INCEVANS CITY 09/18/2000 00929.73750 40-43-53.2 N PA RM WPIH485 079-45-28.2 W 0000253274 PAGING NETWORK OF AMERICA INCMONROEVILLE 09/18/2000 00929.73750 40-26-47.2 N PA RM WPIH485 080-16-59.2 W 0000253274 PAGING NETWORK OF AMERICA INCMOON TOWNSHIP 09/18/2000 00929.73750 40-29-50.2 N SC RM WPDH756 079-50-04.2 W 0000253275 PAGING NETWORK OF AMERICA INCFLORENCE 09/18/2000 00929.96250 34-08-37.6 N NC RM WPIJ419 080-54-07.3 W 0000253313 PAGING NETWORK OF AMERICA INCCHARLOTTE 09/18/2000 00929.58750 35-18-28.5 N NC RM WPIJ419 077-59-14.0 W 0000253313 PAGING NETWORK OF AMERICA INCGOLDSBORO 09/18/2000 00929.58750 35-24-33.6 N NC RM WPIJ419 080-19-18.2 W 0000253313 PAGING NETWORK OF AMERICA INCRURAL HALL 09/18/2000 00929.58750 36-13-47.5 N Page 43 GS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207700A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207700A1.txt
  • Number Frequency (MHz) Applicant Name Latitude City CA MD WPQR877 118-15-35.5 W 0000263829 BACKLINK LLC LOS ANGELES 11/16/2000 18120.00000 34-03-23.9 N CA MD WPQR879 118-15-36.5 W 0000263830 BACKLINK LLC LOS ANGELES 11/16/2000 18040.00000 34-03-03.8 N CA MD WPQR878 118-15-28.3 W 0000263831 BACKLINK LLC LOS ANGELES 11/16/2000 18000.00000 34-03-03.4 N MA MD WPQN339 071-00-54.0 W 0000264390 BACKLINK LLC QUINCY 11/17/2000 18080.00000 42-14-04.2 N MA MD WPQN339 071-00-54.0 W 0000264390 BACKLINK LLC QUINCY 11/17/2000 21575.00000 42-14-04.2 N KS MD WDU220 097-22-07.1 W 0000264436 MID KANSAS INC NEWTON 11/17/2000 06197.24000 38-04-16.0 N KS MD WDU220 097-22-07.1 W 0000264436 MID KANSAS INC NEWTON 11/17/2000 06256.54000 38-04-16.0 N KS MD WDU220 097-22-07.1 W 0000264436 MID KANSAS INC NEWTON 11/17/2000 06256.54000 38-04-16.0 N KS MD WDU220 097-22-07.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208209A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208209A1.txt
  • HIGHLAND 12/01/2000 00929.66250 41-43-09.0 N MD RM KNNF535 075-56-58.0 W 0000280567 PAGEMART II INC LINKWOOD 12/01/2000 00929.66250 38-32-35.0 N IN RM KNNF535 086-25-05.0 W 0000280567 PAGEMART II INC MARTINSVILLE 12/01/2000 00929.66250 39-26-19.2 N CA RM KNNF535 122-35-45.0 W 0000280567 PAGEMART II INC PETALUMA 12/01/2000 00929.66250 38-19-55.0 N CA RM KNNF535 117-09-31.1 W 0000280567 PAGEMART II INC SAN DIEGO 12/01/2000 00929.66250 32-43-04.2 N NY RM KNNF534 073-59-46.0 W 0000280702 PAGEMART II INC HIGHLAND 12/01/2000 00929.71250 41-43-09.0 N MD RM KNNF534 075-56-58.0 W 0000280702 PAGEMART II INC LINKWOOD 12/01/2000 00929.71250 38-32-35.0 N IN RM KNNF534 086-25-05.0 W 0000280702 PAGEMART II INC MARTINSVILLE 12/01/2000 00929.71250 39-26-19.2 N Page 85 GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208420A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208420A1.txt
  • Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY AM 079-34-31.2 W 0000219164 County of Chautauqua Office of the SheriffSherman 12/14/2000 06795.00000 42-08-39.2 N NY AM 079-34-31.2 W 0000219164 County of Chautauqua Office of the SheriffSherman 12/14/2000 06805.00000 42-08-39.2 N NY AM 079-34-31.2 W 0000219164 County of Chautauqua Office of the SheriffSherman 12/14/2000 06845.00000 42-08-39.2 N NY AM 079-42-04.2 W 0000219167 County of Chautauqua Office of the SheriffFindly Lake 12/14/2000 06635.00000 42-05-13.2 N NY AM 079-42-04.2 W 0000219167 County of Chautauqua Office of the SheriffFindly Lake 12/14/2000 06685.00000 42-05-13.2 N NY AM 079-14-21.2 W 0000219169 County of Chautauqua Office of the SheriffJamestown 12/14/2000 06197.24000 42-05-47.2 N NY AM 079-14-21.2 W 0000219169 County of Chautauqua Office of the SheriffJamestown 12/14/2000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208607A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208607A1.txt
  • N AZ MD WPQZ261 111-58-54.9 W 0000304233 BACKLINK LLC PHOENIX 12/21/2000 18120.00000 33-24-45.1 N OR MD WMN732 122-54-32.0 W 0000304838 AT&T Wireless Services of Florida, Inc. SALEM 12/22/2000 06372.05100 44-53-00.0 N OH MD WLT609 080-45-07.3 W 0000304982 PITTSBURGH CELLULAR TELEPHONE COMPANY NORTH BRIDGEPORT 12/22/2000 05945.20000 40-03-41.2 N PA MD WLT608 080-25-20.2 W 0000304995 PITTSBURGH CELLULAR TELEPHONE COMPANY CLAYSVILLE 12/22/2000 06197.24000 40-07-04.2 N NC NE 082-59-22.4 W 0000279804 BellSouth Telecommunications, Inc. Waynesville 12/20/2000 10995.00000 35-29-18.3 N IL NE 088-57-23.0 W 0000286026 Pathnet Decatur 12/18/2000 06197.24000 39-50-40.0 N IL NE 088-57-23.0 W 0000286026 Pathnet Decatur 12/18/2000 06256.54000 39-50-40.0 N ID NE 112-12-09.7 W 0000297015 Edge Wireless Licenses, LLC Shelley 12/18/2000 17815.00000 43-22-11.6 N ID NE 112-17-27.3 W 0000297016 Edge Wireless Licenses, LLC Blackfoot
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208868A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208868A1.txt
  • 39450.00000 - 39500.00000 39-52-30.4 N OR RM WPJC643 R 122-38-02.1 W 0000312918 BIZTEL, INC. (C/O AT&T CORP) EUGENE 01/04/2001 38750.00000 - 38800.00000 43-26-44.4 N OR RM WPJC643 R 122-38-02.1 W 0000312918 BIZTEL, INC. (C/O AT&T CORP) EUGENE 01/04/2001 39450.00000 - 39500.00000 43-26-44.4 N TX RM WPJD292 R 101-12-53.5 W 0000312920 BIZTEL, INC. (C/O AT&T CORP) AMARILLO 01/04/2001 39200.00000 - 39250.00000 34-43-04.2 N TX RM WPJD292 R 101-12-53.5 W 0000312920 BIZTEL, INC. (C/O AT&T CORP) AMARILLO 01/04/2001 39900.00000 - 39950.00000 34-43-04.2 N OK RM WPJB344 R 095-19-12.8 W 0000312956 BIZTEL, INC. (C/O AT&T CORP) TULSA 01/04/2001 39200.00000 - 39250.00000 35-38-26.3 N OK RM WPJB344 R 095-19-12.8 W 0000312956 BIZTEL, INC. (C/O AT&T CORP) TULSA 01/04/2001 39900.00000 - 39950.00000 35-38-26.3 N Page 26
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209092A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209092A1.txt
  • CA NE 121-59-40.4 W 0000322802 FIBERSTREET SANTA CLARA 01/12/2001 22125.00000 37-22-05.8 N CA NE 116-50-42.0 W 749896 Rainbird Sprinkler Mfg Corp San Diego 06/09/1999 21950.00000 32-35-42.2 N CA NE 116-50-42.0 W 749896 Rainbird Sprinkler Mfg Corp San Diego 06/09/1999 23292.50000 32-35-42.2 N CA NE 116-50-42.0 W 749896 Rainbird Sprinkler Mfg Corp San Diego 06/09/1999 23296.50000 32-35-42.2 N WA RM WLW572 120-19-04.2 W 0000319938 NORTHWEST MICROWAVE INC WENNATCHEE 01/10/2001 19360.00000 47-25-03.4 N Page 100 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPJD953 0000315419 PUBLIC SERVICE COMPANY OF NEW MEXICO 01/08/2001 RO WPJD955 0000315433 PUBLIC SERVICE COMPANY OF NEW MEXICO 01/08/2001 RO WNTI472 0000315959 CLARK RADIO ELECTRONICS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209552A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209552A1.txt
  • 41-29-07.9 N NV AM 115-57-35.3 W 0000255293 AT&T Wireless Services of Florida, Inc. PAHRUMP 01/24/2001 10578.12500 36-11-52.4 N MI AM 083-06-58.8 W 0000255961 BACKLINK LLC Troy 01/22/2001 19480.00000 42-33-50.9 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM 117-57-04.2 W 0000259734 Los Angeles SMSA Limited Partnership BALDWIN PARK 01/24/2001 10628.12500 34-06-17.0 N CA AM WPOM244 117-12-07.9 W 0000263609 BACKLINK, L.L.C. San Diego 01/23/2001 17760.00000 32-53-44.3 N CA AM WPOM244 117-12-07.9 W 0000263609 BACKLINK, L.L.C. San Diego 01/23/2001 17800.00000 32-53-44.3 N CA AM WPOM244 117-12-07.9 W 0000263609 BACKLINK, L.L.C. San Diego 01/23/2001 17960.00000 32-53-44.3 N CA AM WPOM244 117-12-07.9 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209663A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209663A1.txt
  • 40 N. - Lon. 96 11 3 W. 1 MI. S.W. OF ROUND PRAIRIE, CORSICANA, TX New Station Other Facilities Changes LEAD CALLSIGN: WMH217 File Number Applicant Channel(s) Station City & State BPMDH-20000818BJZ NUCENTRIX SPECTRUM RESOURCES, INC. 2A CHARLOTTE, TX Call Sign NEW (306328) Non-Common Carrier Status. Lat. 28 50 31 N. - Lon. 98 45 30 W. LOCATED APPROXIMATELY 4.2 KM (2.6 MILES) WEST OF CHARLOTTE,, CHARLOTTE, TX New Station Other Facilities Changes BTA: 401 San Antonio, TX LEAD CALLSIGN: KNSC778 File Number Applicant Channel(s) Station City & State BPMD-20000818CYL NUCENTRIX SPECTRUM RESOURCES, INC. EG PEORIA, IL Call Sign NEW (307544) Non-Common Carrier Status. Lat. 40 43 52 N. - Lon. 89 37 0 W. 3517 DRIES LANE, PEORIA, IL,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209814A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209814A1.txt
  • BACKLINK LLC Los Angeles 02/01/2001 22975.00000 34-03-42.7 N CA NE 118-22-33.0 W 0000353979 BACKLINK LLC Beverly Hills 02/01/2001 19360.00000 34-03-46.8 N SD NE 101-52-13.0 W 0000354010 WWC License LLC Martin 02/01/2001 06745.00000 43-10-43.0 N SD NE 102-37-14.2 W 0000354011 WWC License LLC Pine Ridge 02/01/2001 06715.62500 43-10-19.1 N SD NE 102-41-34.6 W 0000354012 WWC License LLC Pine Ridge 02/01/2001 06383.17000 43-31-04.2 N SD NE 102-41-34.6 W 0000354012 WWC License LLC Pine Ridge 02/01/2001 06545.62500 43-31-04.2 N SD NE 101-56-09.3 W 0000354014 WWC License LLC Martin 02/01/2001 06110.75000 43-32-27.0 N SD NE 101-56-09.3 W 0000354014 WWC License LLC Martin 02/01/2001 06131.13000 43-32-27.0 N SD NE 101-56-09.3 W 0000354014 WWC License LLC Martin 02/01/2001 06585.00000 43-32-27.0 N Page 22 CF - Common Carrier
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210072A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210072A1.txt
  • 111-55-34.9 W 0000362501 BACKLINK LLC Scottsdale 02/08/2001 19520.00000 33-32-04.1 N AZ NE 111-55-29.1 W 0000362502 BACKLINK LLC Scottsdale 02/08/2001 19400.00000 33-32-40.6 N TX NE 095-24-16.5 W 0000362728 KATLINK LLC Houston 02/08/2001 22575.00000 29-42-21.8 N TX NE 095-24-03.2 W 0000362729 KATLINK LLC Houston 02/08/2001 21375.00000 29-41-31.8 N CA NE 117-19-00.9 W 0000362832 BACKLINK LLC Carlsbad 02/08/2001 22825.00000 33-06-56.6 N CA NE 117-19-04.2 W 0000362833 BACKLINK LLC Carlsbad 02/08/2001 21425.00000 33-07-47.7 N Page 32 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 117-19-04.2 W 0000362833 BACKLINK LLC Carlsbad 02/08/2001 21625.00000 33-07-47.7 N CA NE 117-19-35.1 W 0000362834 BACKLINK LLC Carlsbad 02/08/2001 22625.00000 33-07-38.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210801A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210801A1.txt
  • Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IA AM KYP21 091-41-42.5 W 0000098102 CEDAR RAPIDS TELEVISION COMPANYHIAWATHA 02/26/2001 07100.00000 - 07125.00000 42-03-25.0 N MO NE 090-17-21.0 W 0000066602 KTVI LICENSE INC ST. LOUIS 12/27/1999 07100.00000 - 07125.00000 38-37-49.0 N AR NE 094-10-41.7 W 0000378923 TV34, Inc. Rogers 02/26/2001 12812.50000 36-20-04.2 N IA NE 093-34-04.0 W 0000380972 KPWB Ankeny 02/27/2001 06937.50000 41-42-08.0 N IA NE 093-36-57.0 W 0000381156 KPWB SLATER 02/27/2001 07062.50000 41-49-47.0 N MO NE 093-44-20.2 W 0000381432 The Board of Governors of Central Missouri State University Warrensburg 02/27/2001 06887.50000 38-45-25.9 N MO NE 093-44-20.2 W 0000381432 The Board of Governors of Central Missouri State University Warrensburg 02/27/2001 07112.50000 38-45-25.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211021A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211021A1.txt
  • Realty and Equipment Co. LLC DBA= American Personal Communication CEDAR HEIGHTS 03/08/2001 17755.00000 39-11-59.0 N WI NE 092-39-04.6 W 0000391611 VoiceStream PCS I License L.L.C. Hudson 03/08/2001 06725.00000 45-02-00.7 N IL NE 087-46-47.5 W 0000391853 BACKLINK LLC Chicago 03/09/2001 19560.00000 41-54-54.3 N CA NE 122-16-05.1 W 0000391892 AT&T Wireless Services of Florida, Inc. Hercules 03/09/2001 19385.00000 38-01-05.4 N IN NE 086-07-04.2 W 0000391999 BACKLINK LLC Indianapolis 03/09/2001 18120.00000 39-54-22.0 N IN NE 086-07-06.7 W 0000392001 BACKLINK LLC Indianapolis 03/09/2001 17920.00000 39-54-19.7 N CA NE 122-24-05.0 W 0000392056 BACKLINK LLC San Francisco 03/09/2001 19680.00000 37-47-52.8 N CA NE 117-53-08.3 W 0000392070 Los Angeles SMSA Limited Partnership Fullerton 03/09/2001 19525.00000 33-52-29.8 N Page 23 CF - Common Carrier Fixed Point to Point Microwave
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211250A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211250A1.txt
  • INC 08/28/2000 00468.40000 WA NE 122-22-09.6 W D146494 WIZTRONICS INC BELLINGHAM 08/28/2000 00463.40000 48-46-56.4 N RM KYN595 A 0000393088 BALTUS, BERTRAM 03/01/2001 00463.32500 RM KYN595 A 0000393088 BALTUS, BERTRAM 03/01/2001 00468.32500 IN RM KYN595 X 0000393088 BALTUS, BERTRAM 03/01/2001 00466.15000 IN RM KYN595 X 0000393088 BALTUS, BERTRAM 03/01/2001 00468.32500 IN RM KYN595 P 085-35-54.9 W 0000393088 BALTUS, BERTRAM 03/01/2001 00461.15000 39-20-04.2 N IN RM KYN595 P 085-35-54.9 W 0000393088 BALTUS, BERTRAM 03/01/2001 00466.15000 39-20-04.2 N IN RM KYN595 085-35-54.9 W 0000393088 BALTUS, BERTRAM MILFORD 03/01/2001 00461.15000 39-20-04.2 N IN RM KYN595 085-35-54.9 W 0000393088 BALTUS, BERTRAM MILFORD 03/01/2001 00463.32500 39-20-04.2 N RM WNVS258 A 0000393477 SHILOH, DELMAR 03/05/2001 00461.87500 RM WNVS258 A 0000393477 SHILOH, DELMAR 03/05/2001 00461.87500 RM WNVS258 A 0000393477
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211420A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211420A1.txt
  • N CA MD WLR559 117-57-10.9 W 0000400212 PACIFIC BELL EDWARDS AFB 03/19/2001 10795.00000 34-54-50.4 N CA MD WLR559 117-57-10.9 W 0000400212 PACIFIC BELL EDWARDS AFB 03/19/2001 10875.00000 34-54-50.4 N CA MD WLR559 117-57-10.9 W 0000400212 PACIFIC BELL EDWARDS AFB 03/19/2001 10955.00000 34-54-50.4 N CA MD WLR559 117-57-10.9 W 0000400212 PACIFIC BELL EDWARDS AFB 03/19/2001 18645.00000 34-54-50.4 N CA MD WLA630 117-46-04.2 W 0000400213 PACIFIC BELL PALMDALE 03/19/2001 05974.85000 34-28-11.5 N CA MD WLA630 117-46-04.2 W 0000400213 PACIFIC BELL PALMDALE 03/19/2001 06004.50000 34-28-11.5 N CA MD WLA630 117-46-04.2 W 0000400213 PACIFIC BELL PALMDALE 03/19/2001 06034.15000 34-28-11.5 N CA MD WLA630 117-46-04.2 W 0000400213 PACIFIC BELL PALMDALE 03/19/2001 06063.80000 34-28-11.5 N CA MD WLA630 117-46-04.2 W 0000400213 PACIFIC BELL PALMDALE 03/19/2001 06093.45000 34-28-11.5
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212302A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212302A1.txt
  • Inc Vaughn 03/23/2001 00451.30000 47-31-09.9 N MT NE 111-33-53.0 W 0000405182 Cutthroat Communications Inc Vaughn 03/23/2001 00451.55000 47-31-09.9 N MT NE 111-33-53.0 W 0000405182 Cutthroat Communications Inc Vaughn 03/23/2001 00452.37500 47-31-09.9 N MT NE 111-33-53.0 W 0000405182 Cutthroat Communications Inc Vaughn 03/23/2001 00452.70000 47-31-09.9 N NC NE 078-46-36.0 W 0000406263 METROCALL USA INC BUTNER 03/21/2001 00462.80000 36-08-16.5 N SC NE 079-50-04.2 W 0000406281 METROCALL USA INC FLORENCE 03/21/2001 00462.80000 34-08-38.4 N RO KNNW763 0000406729 STATE SYSTEMS RADIO INC 03/26/2001 RO KNNR601 0000407897 DREIER, JAMES 03/27/2001 RO KNNR602 0000407898 DREIER, JAMES 03/27/2001 RO KNNR603 0000407899 DREIER, JAMES 03/27/2001 RO KNNR604 0000407900 DREIER, JAMES 03/27/2001 RO KNNR600 0000407903 DREIER, JAMES 03/27/2001 RO WNVZ461 0000410017 LAWRENCE, RON 03/21/2001 RO WNVN526 0000410020 TRACY CORPORATION II
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212840A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212840A1.txt
  • PR NE 066-15-12.7 W 0000452540 SprintCom, Inc. TOA BAJA 05/08/2001 18110.00000 18-26-32.5 N PR NE 066-13-58.3 W 0000452708 SprintCom, Inc. TOA BAJA 05/08/2001 19550.00000 18-24-31.7 N MA NE 070-56-51.2 W 0000454370 AT&T CORP LYNN 05/09/2001 22675.00000 42-27-48.4 N MA NE 070-56-51.2 W 0000454370 AT&T CORP LYNN 05/09/2001 22825.00000 42-27-48.4 N MA NE 070-58-15.8 W 0000454371 AT&T CORP LYNN 05/09/2001 21475.00000 42-27-04.2 N MA NE 070-58-15.8 W 0000454371 AT&T CORP LYNN 05/09/2001 21625.00000 42-27-04.2 N PR NE 066-17-24.3 W 0000454504 SprintCom, Inc. DORADO 05/09/2001 17850.00000 18-27-18.8 N PR NE 066-17-24.3 W 0000454504 SprintCom, Inc. DORADO 05/09/2001 19670.00000 18-27-18.8 N PR NE 066-20-32.1 W 0000454519 SprintCom, Inc. BRENAS 05/09/2001 19410.00000 18-27-53.3 N PR NE 066-20-32.1 W 0000454519 SprintCom, Inc. BRENAS 05/09/2001 19425.00000 18-27-53.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213235A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213235A1.txt
  • WINTER PARK 05/25/2001 00941.36875 28-35-39.0 N FL NE 081-18-05.0 W 0000473116 Orange, County of ORLANDO 05/25/2001 00932.30625 28-35-39.0 N FL NE 081-18-05.0 W 0000473116 Orange, County of ORLANDO 05/25/2001 00941.30625 28-35-39.0 N FL NE 081-12-29.0 W 0000473142 Orange, County of ORLANDO 05/25/2001 00932.36875 28-28-42.0 N FL NE 081-12-29.0 W 0000473142 Orange, County of ORLANDO 05/25/2001 00941.36875 28-28-42.0 N CA NE 117-45-04.2 W 0000473154 Pomona Valley Hospital Medical Center Pomona 05/25/2001 21875.00000 34-04-40.0 N CA NE 117-44-43.0 W 0000473175 Pomona Valley Hospital Medical Center Pomona 05/25/2001 23075.00000 34-04-37.0 N VI NE 064-56-38.7 W 0000473334 BANCO POPULAR DE PUERTO RICO SAN THOMAS 05/25/2001 06585.00000 18-02-15.2 N VI NE 064-56-38.7 W 0000473334 BANCO POPULAR DE PUERTO RICO SAN THOMAS 05/25/2001 10577.50000 18-02-15.2 N CA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213765A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213765A1.txt
  • 06/11/2001 06093.45000 41-44-06.5 N CA MD KMZ81 122-50-27.1 W 0000486294 SISKIYOU TELEPHONE COMPANY FORT JONES 06/11/2001 06226.89000 41-36-25.4 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD WLC414 080-49-08.6 W 0000486389 YOUNGSTOWN/WARREN MSA LIMITED PARTNERSHIP WARREN 06/11/2001 02165.20000 41-14-04.2 N OH MD WLC414 080-49-08.6 W 0000486389 YOUNGSTOWN/WARREN MSA LIMITED PARTNERSHIP WARREN 06/11/2001 02174.80000 41-14-04.2 N OH MD WLC414 080-49-08.6 W 0000486389 YOUNGSTOWN/WARREN MSA LIMITED PARTNERSHIP WARREN 06/11/2001 06345.49000 41-14-04.2 N OH MD WLM623 080-36-55.6 W 0000486490 YOUNGSTOWN/WARREN MSA LIMITED PARTNERSHIP BROOKFIELD 06/11/2001 02115.20000 41-15-53.4 N OH MD WLM623 080-36-55.6 W 0000486490 YOUNGSTOWN/WARREN MSA LIMITED PARTNERSHIP BROOKFIELD 06/11/2001 02124.80000 41-15-53.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213963A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213963A1.txt
  • Teletouch Licenses, Inc. TYLER 06/20/2001 00075.50000 32-21-06.0 N Page 24 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WPBR261 095-18-07.0 W 0000497310 Teletouch Licenses, Inc. TYLER 06/20/2001 00075.50000 32-21-06.0 N OH NE 081-41-39.5 W 0000498994 Mobile Communication Service, Inc. CLEVELAND 06/13/2001 00152.48000 41-30-04.2 N RO WPHN916 0000494243 AT&T OF THE VIRGIN ISLANDS 06/19/2001 RO WPJL457 0000494266 ALPHA WIRELESS COMMUNICATIONS CO. 06/19/2001 RO WNWN459 0000494335 PAGE ONE OF WYOMING INC 06/19/2001 RO WNWU974 0000494594 MORTON II, ROBERT T:MORTON, KAREN S DBA INDIAN SPRINGS ENTERPRISES 06/19/2001 RO WPIH279 0000495379 WASHINGTON COMMUNICATIONS LLC DBA DAY WIRELESS SYSTEMS 06/19/2001 RO WPJK564 0000496637 MOBEX IDAHO INC 06/20/2001 RO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214269A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214269A1.txt
  • 0000512608 CAL-ONE CELLULAR L.P. Etna 07/05/2001 41-26-57.0 N KS MD KNKA255 097-23-27.4 W 0000513760 WICHITA SMSA LIMITED PARTNERSHIPVALLEY CENTER 07/06/2001 37-52-32.8 N GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD WPGF236 084-11-19.4 W 0000513490 P & R COMMUNICATIONS INC PIQUA 07/06/2001 00929.31250 40-07-04.2 N MO RM WPJL579 089-35-34.0 W 0000507697 PAGEMART II INC CAPE GIRARDEAU 07/02/2001 00929.76250 37-22-07.0 N AR RM WPJL579 092-20-56.6 W 0000507697 PAGEMART II INC CONWAY 07/02/2001 00929.76250 35-07-22.3 N TN RM WPJL579 084-34-49.0 W 0000507697 PAGEMART II INC HARRIMAN 07/02/2001 00929.76250 35-55-41.0 N CA RM WPJL579 118-29-10.3 W 0000507697 PAGEMART II INC SANTA MONICA 07/02/2001 00929.76250 34-00-38.0 N GX
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214594A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214594A1.txt
  • N PR NE 066-33-02.1 W 0000520393 SprintCom, Inc. EXEDENTE 07/11/2001 17905.00000 18-03-52.9 N PR NE 065-37-49.8 W 0000520636 SprintCom, Inc. CROABAS 07/11/2001 19305.00000 18-21-41.9 N PR NE 065-39-22.0 W 0000520840 SprintCom, Inc. CEIBA 07/11/2001 19385.00000 18-16-03.0 N PR NE 065-37-13.6 W 0000520870 SprintCom, Inc. PUERTO REAL 07/11/2001 19405.00000 18-20-28.8 N PR NE 066-36-15.1 W 0000521370 SprintCom, Inc. Arecibo 07/11/2001 11325.00000 18-26-04.2 N PR NE 066-36-15.1 W 0000521370 SprintCom, Inc. Arecibo 07/11/2001 11685.00000 18-26-04.2 N PR NE 066-36-15.1 W 0000521370 SprintCom, Inc. Arecibo 07/11/2001 19565.00000 18-26-04.2 N PR NE 066-12-40.7 W 0000521566 SprintCom, Inc. CAYEY 07/11/2001 17885.00000 18-03-55.7 N PR NE 066-48-33.1 W 0000521571 SprintCom, Inc. GUAYANILLA 07/11/2001 19445.00000 18-02-11.9 N PR NE 066-48-33.1 W 0000521571 SprintCom, Inc. GUAYANILLA 07/11/2001 19550.00000 18-02-11.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214800A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214800A1.txt
  • 23175.00000 28-31-25.3 N SD NE 097-48-06.0 W 0000530169 Northwestern Public Service Company CLARK 07/19/2001 02184.80000 44-52-42.0 N SD NE 097-48-06.0 W 0000530169 Northwestern Public Service Company CLARK 07/19/2001 02192.80000 44-52-42.0 N SD NE 097-48-06.0 W 0000530169 Northwestern Public Service Company CLARK 07/19/2001 02192.80000 44-52-42.0 N NM NE 107-18-13.2 W 0000530712 WILLIAMS ENERGY SERVICES GOBERNADOR 07/11/2001 00958.65000 36-31-14.0 N NM NE 107-57-04.2 W 0000530825 WILLIAMS ENERGY SERVICES BLOOMFIELD 07/11/2001 01900.00000 36-43-47.0 N UT NE 112-12-10.0 W 0000531794 Bonneville Holding Company SALT LAKE CITY 07/20/2001 06256.54000 40-39-33.0 N UT NE 111-54-00.8 W 0000531795 Bonneville Holding Company SALT LAKE CITY 07/20/2001 06004.50000 40-46-12.8 N RO WNEO889 0000524983 AUSTIN, CITY OF 07/16/2001 RO KMR88 0000525005 Tosco Refining Company 07/16/2001 RO KMT72 0000525007 Tosco Refining Company
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215309A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215309A1.txt
  • 7,106,229 * Data witheld to maintain firm confidentiality. High-Speed Lines by Type of User Table 7 (Over 200 kbps in at Least One Direction) 1/ Other includes medium and large business, institutional, and government customers. Number of Providers Zero 44.0% 30.1% 25.0% One 24.5 25.8 24.5 Two 14.2 16.7 18.6 Three 8.1 9.3 10.7 Four 4.4 6.0 6.2 Five 2.6 4.2 4.1 Six 1.5 3.1 3.0 Seven 0.6 2.2 2.3 Eight 0.2 1.2 2.0 Nine 0.0 0.6 1.6 Ten or More 0.0 0.9 2.1 * Data for June 2000 have been revised. December 1999 June 2000* December 2000 Table 8 Percentage of Zip Codes with High-Speed Lines in Service High-Speed Providers by Zip Code Number of Reporting Providers 7 or more
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215390A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215390A1.txt
  • INC 08/09/2001 RO WWM2 0000554088 AERONAUTICAL RADIO INC 08/09/2001 RO WXZ5 0000554089 AERONAUTICAL RADIO INC 08/09/2001 RO WXB4 0000554591 J A AIR CENTER 08/09/2001 Page 4 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH AM 081-20-12.7 W 0000151719 Kent State University KENT 08/06/2001 00947.50000 41-09-04.2 N NM AM 106-45-32.0 W 0000486720 Moody Bible Institute of Chicago Las Cruces 08/03/2001 00945.00000 32-17-52.0 N TN AM 084-29-59.7 W 0000497343 The Kingston Century Club, Inc. Kingston 08/08/2001 00947.87500 35-52-28.2 N FL AM 082-20-50.4 W 0000502016 THE UNIVERSITY OF FLORIDA GAINESVILLE 08/08/2001 00945.00000 29-38-51.9 N IL AM 088-18-39.8 W 0000503745 AAA Entertainment Licensing LLC Champaign 08/09/2001 00944.50000 40-07-00.4 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215526A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215526A1.txt
  • 13.2 10.6 5,488 Florida 49.4 21.5 9.1 20.0 223,503 Georgia 48.7 29.3 3.3 18.8 62,360 Idaho 35.1 19.9 6.7 38.3 17,348 Illinois 46.3 22.0 6.4 25.3 102,295 Indiana 51.9 17.6 7.2 23.3 54,944 Iowa 40.7 25.0 4.5 29.8 34,979 Kansas 34.1 12.5 19.2 34.1 19,707 Kentucky 49.5 15.5 7.9 27.1 35,217 Louisiana 49.2 16.4 5.1 29.4 34,739 Maine 43.5 22.0 4.2 30.3 5,812 Maryland 39.6 32.3 5.8 22.3 62,912 Massachusetts 57.4 20.3 10.1 12.1 25,218 Michigan 51.8 15.4 9.3 23.6 89,987 Minnesota 46.1 23.7 7.8 22.4 56,207 Mississippi 59.0 25.3 2.7 13.0 22,046 Missouri 46.5 11.2 12.4 29.9 26,396 Montana 44.0 11.3 5.0 39.7 13,359 Nebraska 41.7 24.8 8.9 24.6 18,079 Nevada 37.2 20.4 11.9 30.4 25,971 New Hampshire 47.1 21.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215731A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215731A1.txt
  • COMPANYCAIRO 08/24/2001 10715.00000 37-00-14.2 N IL MD WLT388 089-10-16.3 W 0000570785 ILLINOIS BELL TELEPHONE COMPANYCAIRO 08/24/2001 10755.00000 37-00-14.2 N IL MD WLT388 089-10-16.3 W 0000570785 ILLINOIS BELL TELEPHONE COMPANYCAIRO 08/24/2001 10915.00000 37-00-14.2 N IL MD WLT388 089-10-16.3 W 0000570785 ILLINOIS BELL TELEPHONE COMPANYCAIRO 08/24/2001 11115.00000 37-00-14.2 N IL MD WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 08/24/2001 02161.50000 37-05-04.2 N IL MD WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 08/24/2001 06063.80000 37-05-04.2 N IL MD WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 08/24/2001 11215.00000 37-05-04.2 N IL MD WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 08/24/2001 11245.00000 37-05-04.2 N IL MD WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 08/24/2001 11405.00000 37-05-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215884A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215884A1.txt
  • SHILOH 08/30/2001 00862.76250 38-32-51.2 N IL MD WNBZ633 089-55-03.4 W 0000576958 KLL WIRELESS INC SHILOH 08/30/2001 00863.76250 38-32-51.2 N IL MD WNBZ633 089-55-03.4 W 0000576958 KLL WIRELESS INC SHILOH 08/30/2001 00864.76250 38-32-51.2 N IL MD WNBZ633 089-55-03.4 W 0000576958 KLL WIRELESS INC SHILOH 08/30/2001 00865.76250 38-32-51.2 N IL MD WPPY573 088-56-29.2 W 0000576990 KLL WIRELESS INC MOUNT VERNON 08/30/2001 00856.56250 38-17-04.2 N IL MD WPPY573 088-56-29.2 W 0000576990 KLL WIRELESS INC MOUNT VERNON 08/30/2001 00857.56250 38-17-04.2 N IL MD WPPY573 088-56-29.2 W 0000576990 KLL WIRELESS INC MOUNT VERNON 08/30/2001 00858.56250 38-17-04.2 N IL MD WPPY573 088-56-29.2 W 0000576990 KLL WIRELESS INC MOUNT VERNON 08/30/2001 00859.56250 38-17-04.2 N IL MD WPPY573 088-56-29.2 W 0000576990 KLL WIRELESS INC MOUNT VERNON 08/30/2001 00860.56250 38-17-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216016A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216016A1.txt
  • 09/04/2001 00122.72500 28-50-01.9 N GM NE 087-46-51.9 W 0000583164 CHEVRON USA INC Offshore 09/04/2001 00122.72500 29-13-45.8 N PR NE 066-05-55.0 W 0000586702 Aeronautical Radio Inc. San Juan 09/07/2001 00129.05000 18-27-24.0 N GA NE 084-35-54.7 W 0000586709 Aeronautical Radio Inc. Marietta 09/07/2001 00130.22500 34-00-47.3 N NY NE 073-42-27.2 W 0000586713 Aeronautical Radio Inc. White Plains 09/07/2001 00130.47500 41-04-01.0 N CA NE 117-36-04.2 W 0000586724 Aeronautical Radio Inc. Ontario 09/07/2001 00131.32500 34-03-21.6 N RO WDS9 0000581970 MIFFLIN COUNTY AIRPORT AUTHORITY 09/04/2001 RO KZB2 0000584425 BOWMAN AVIATION INC 09/05/2001 RO WCE6 0000585080 SOLANO, COUNTY OF 09/06/2001 RO KBR4 0000585138 AERONAUTICAL RADIO INC 09/06/2001 RO KBX3 0000585139 AERONAUTICAL RADIO INC 09/06/2001 RO KFC7 0000585140 AERONAUTICAL RADIO INC 09/06/2001 RO KNK9 0000585141 AERONAUTICAL RADIO INC 09/06/2001
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216205A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216205A1.txt
  • W 0000589973 Cellco Partnership dba Verizon WirelessRIPLEY 09/12/2001 35-46-19.0 N Page 22 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN RM KNKN574 088-04-19.1 W 0000589973 Cellco Partnership dba Verizon WirelessSUGAR TREE 09/12/2001 35-51-07.2 N TN RM KNKN574 089-03-05.2 W 0000589973 Cellco Partnership dba Verizon WirelessUnion City 09/12/2001 36-26-04.2 N TN RM KNKN574 089-03-05.2 W 0000589973 Cellco Partnership dba Verizon WirelessUnion City 09/12/2001 36-26-04.2 N TN RM KNKN574 089-03-05.2 W 0000589973 Cellco Partnership dba Verizon WirelessUnion City 09/12/2001 36-26-04.2 N TN RM KNKN574 088-29-30.2 W 0000589973 Cellco Partnership dba Verizon WirelessUNION CROSS 09/12/2001 35-46-33.2 N TN RM KNKN574 088-29-30.2 W 0000589973 Cellco Partnership dba Verizon WirelessUNION CROSS 09/12/2001 35-46-33.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216388A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216388A1.txt
  • d/b/a Verizon WirelessBrockport 09/19/2001 41-15-43.2 N PA RM KNKN810 079-01-55.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessBROOKVILLE 09/19/2001 41-09-00.2 N PA RM KNKN810 078-39-48.2 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessDEGOLIA 09/19/2001 41-54-59.5 N PA RM KNKN810 078-15-18.0 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessEMPORIUM 09/19/2001 41-29-29.2 N PA RM KNKN810 078-48-13.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessLAMONT 09/19/2001 41-37-04.2 N PA RM KNKN810 078-42-06.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessRIDGEWAY 09/19/2001 41-24-34.2 N PA RM KNKN810 078-23-04.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessSMETHPORT 09/19/2001 41-48-37.2 N PA RM KNKQ275 079-54-00.2 W 0000595936 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP Bullion 09/19/2001 41-14-48.2 N OH RM KNKQ275 080-35-03.3 W 0000595936 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP CONNEAUT 09/19/2001 41-54-02.2 N PA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216935A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216935A1.txt
  • 18-09-22.9 N PR AM WPSP492 066-05-01.6 W 0000566432 NewComm Wireless Services, Inc. CAYEY 10/11/2001 11627.50000 18-09-22.9 N PR AM WPSP492 066-05-01.6 W 0000566432 NewComm Wireless Services, Inc. CAYEY 10/11/2001 11631.25000 18-09-22.9 N PR AM WPSP492 066-05-01.6 W 0000566432 NewComm Wireless Services, Inc. CAYEY 10/11/2001 11685.00000 18-09-22.9 N IL AM WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 10/09/2001 02161.50000 37-05-04.2 N IL AM WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 10/09/2001 06063.80000 37-05-04.2 N IL AM WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 10/09/2001 11215.00000 37-05-04.2 N IL AM WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 10/09/2001 11245.00000 37-05-04.2 N IL AM WLT387 089-09-51.3 W 0000570799 ILLINOIS BELL TELEPHONE COMPANYMOUND CITY 10/09/2001 11405.00000 37-05-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217280A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217280A1.txt
  • 11405.00000 40-24-55.1 N PA NE 080-02-17.7 W 0000638500 Pittsburgh SMSA Limited Partnership PITTSBURGH 10/24/2001 11485.00000 40-24-55.1 N PA NE 080-02-17.7 W 0000638500 Pittsburgh SMSA Limited Partnership PITTSBURGH 10/24/2001 11605.00000 40-24-55.1 N PA NE 080-02-17.7 W 0000638500 Pittsburgh SMSA Limited Partnership PITTSBURGH 10/24/2001 11685.00000 40-24-55.1 N TX NE 098-23-32.5 W 0000638778 Sprint Spectrum L.P. Pleasanton 10/24/2001 06621.25000 28-50-48.6 N CA NE 118-17-04.2 W 0000639750 TV MICROWAVES CO Glendale 10/25/2001 06034.15000 34-09-37.0 N CA NE 118-17-04.2 W 0000639750 TV MICROWAVES CO Glendale 10/25/2001 06034.15000 34-09-37.0 N TX NE 098-15-02.0 W 0000639774 Sprint Spectrum L.P. Whitsett 10/25/2001 06781.25000 28-40-13.7 N FL NE 081-58-02.8 W 0000639818 M/A Com Private Radio Systems, Inc. Punta Gorda 10/25/2001 06004.50000 26-49-46.3 N FL NE 081-58-02.8 W 0000639818 M/A Com
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217478A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217478A1.txt
  • 121-23-00.1 W 0000644480 Pacific Bell Wireless, LLC HOLLISTER 10/31/2001 18772.50000 36-57-07.3 N CA MD WPOL851 121-23-00.1 W 0000644480 Pacific Bell Wireless, LLC HOLLISTER 10/31/2001 18797.50000 36-57-07.3 N CA MD WPOL850 121-22-36.4 W 0000644483 Pacific Bell Wireless, LLC HOLLISTER 10/31/2001 19112.50000 36-59-44.8 N CA MD WPOL850 121-22-36.4 W 0000644483 Pacific Bell Wireless, LLC HOLLISTER 10/31/2001 19565.00000 36-59-44.8 N NC MD WPNL439 082-37-04.2 W 0000644954 NORTH CAROLINA RSA #4, INC. ETOWAH 10/31/2001 06421.25000 35-20-07.9 N NC MD WPNL439 082-37-04.2 W 0000644954 NORTH CAROLINA RSA #4, INC. ETOWAH 10/31/2001 06820.00000 35-20-07.9 N CA MD WMQ786 115-04-06.9 W 0000645788 AB Cellular LA, LLC GOFFS 11/01/2001 06034.15000 34-52-49.9 N CA MD WPOL581 122-22-49.2 W 0000645806 Pacific Bell Wireless, LLC HALF MOON BAY 11/01/2001 17915.00000 37-29-42.8 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217635A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217635A1.txt
  • MD WPQP559 120-25-40.0 W 0000649843 Western Sub-RSA Limited Partnership SELAH 11/06/2001 11623.12500 46-47-56.0 N WA MD WPQP559 120-25-40.0 W 0000649843 Western Sub-RSA Limited Partnership SELAH 11/06/2001 11633.12500 46-47-56.0 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA MD KTF80 120-02-04.2 W 0000650372 Verizon Northwest Inc. CHELAN 11/06/2001 02121.60000 47-48-26.4 N WA MD WHU42 119-38-20.1 W 0000650373 Verizon Northwest Inc. MANSFIELD 11/06/2001 02171.60000 47-48-44.5 N WA MD WHU42 119-38-20.1 W 0000650373 Verizon Northwest Inc. MANSFIELD 11/06/2001 11405.00000 47-48-44.5 N CA MD WMQ915 120-26-12.3 W 0000650383 PACIFIC BELL PORTOLA 11/06/2001 06004.50000 39-46-08.4 N CA MD WMQ915 120-26-12.3 W 0000650383 PACIFIC BELL PORTOLA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217848A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217848A1.txt
  • 079-39-02.2 W 0000659727 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP TITUSVILLE 11/15/2001 02121.60000 41-38-16.7 N PA MD WMW284 079-39-02.2 W 0000659727 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP TITUSVILLE 11/15/2001 06207.12000 41-38-16.7 N PA MD WMW284 079-39-02.2 W 0000659727 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP TITUSVILLE 11/15/2001 06372.67000 41-38-16.7 N PA MD WMT728 079-40-01.5 W 0000659823 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP OIL CITY 11/15/2001 02165.20000 41-27-04.2 N PA MD WMT728 079-40-01.5 W 0000659823 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP OIL CITY 11/15/2001 02178.00000 41-27-04.2 N Page 12 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WMT728 079-40-01.5 W 0000659823 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP OIL CITY 11/15/2001
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218188A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218188A1.txt
  • City AM WNMU959 A 0000569243 WILLSON, JAMES E 11/28/2001 00461.62500 AM WNMU959 A 0000569243 WILLSON, JAMES E 11/28/2001 00464.47500 AM WNMU959 A 0000569243 WILLSON, JAMES E 11/28/2001 00466.62500 AM WNMU959 A 0000569243 WILLSON, JAMES E 11/28/2001 00469.47500 CA AM WNMU959 X 0000569243 WILLSON, JAMES E 11/28/2001 00466.62500 CA AM WNMU959 X 0000569243 WILLSON, JAMES E 11/28/2001 00469.47500 CA AM WNMU959 122-27-04.2 W 0000569243 WILLSON, JAMES E REDDING 11/28/2001 00461.62500 40-33-27.6 N CA AM WNMU959 122-27-04.2 W 0000569243 WILLSON, JAMES E REDDING 11/28/2001 00464.47500 40-33-27.6 N Page 21 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM WPBR753 097-18-55.6 W 0000587357 METROCALL USA INC Cuero
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218363A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218363A1.txt
  • 10618.12500 41-44-40.4 N AZ NE 109-57-35.0 W 0000680869 CNG COMMUNICATIONS, INC. MULE MOUNTAIN 12/04/2001 17825.00000 31-28-53.3 N AZ NE 109-33-12.3 W 0000680874 CNG COMMUNICATIONS, INC. DOUGLAS 12/04/2001 19385.00000 31-20-12.8 N TX NE 096-01-17.0 W 0000680875 HOUSTON 10 MHZ LLC Buffalo 12/04/2001 06695.00000 31-22-58.0 N TX NE 095-59-14.0 W 0000680904 HOUSTON 10 MHz LLC Centerville 12/04/2001 06855.00000 31-13-25.0 N CA NE 118-17-04.2 W 0000681002 TV MICROWAVES CO Glendale 12/04/2001 06034.15000 34-09-37.0 N CA NE 118-17-04.2 W 0000681002 TV MICROWAVES CO Glendale 12/04/2001 06034.15000 34-09-37.0 N AZ NE 111-14-52.7 W 0000681118 CNG COMMUNICATIONS, INC. TUBA CITY 12/04/2001 17825.00000 36-08-48.7 N AZ NE 111-14-52.7 W 0000681118 CNG COMMUNICATIONS, INC. TUBA CITY 12/04/2001 17920.00000 36-08-48.7 N AZ NE 111-14-12.4 W 0000681125 CNG COMMUNICATIONS, INC. TUBA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218761A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218761A1.txt
  • TX NE 096-06-51.0 W 0000702269 HOUSTON 10 MHz LLC North Zulch 12/18/2001 06545.00000 30-59-44.0 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 096-06-51.0 W 0000702269 HOUSTON 10 MHz LLC North Zulch 12/18/2001 06595.00000 30-59-44.0 N CA NE 118-20-04.2 W 0000702296 TV Microwaves Co Los Angeles 12/18/2001 21225.00000 34-09-19.0 N CA NE 118-21-33.2 W 0000702324 TV Microwaves Co Los Angeles 12/18/2001 11035.00000 34-04-29.0 N CA NE 118-16-54.2 W 0000702338 TV Microwaves Co Los Angeles 12/18/2001 11285.00000 34-06-12.0 N CA NE 118-19-59.2 W 0000702348 TV Microwaves Co Los Angeles 12/18/2001 06123.10000 34-09-26.0 N CA NE 118-04-01.2 W 0000702358 TV Microwaves
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218852A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218852A1.txt
  • W 0000709777 CELLCO PARTNERSHIP TYLERSPORT 12/21/2001 05974.85000 40-20-43.3 N PA MD WAH496 075-25-05.6 W 0000709777 CELLCO PARTNERSHIP TYLERSPORT 12/21/2001 06034.15000 40-20-43.3 N PA MD WAH496 075-25-05.6 W 0000709777 CELLCO PARTNERSHIP TYLERSPORT 12/21/2001 06093.45000 40-20-43.3 N PA MD WAH496 075-25-05.6 W 0000709777 CELLCO PARTNERSHIP TYLERSPORT 12/21/2001 06152.75000 40-20-43.3 N PA MD WBA994 075-51-40.7 W 0000709804 CELLCO PARTNERSHIP MOUNTAIN TOP 12/21/2001 05945.20000 41-11-04.2 N PA MD WBA994 075-51-40.7 W 0000709804 CELLCO PARTNERSHIP MOUNTAIN TOP 12/21/2001 05974.85000 41-11-04.2 N PA MD WBA994 075-51-40.7 W 0000709804 CELLCO PARTNERSHIP MOUNTAIN TOP 12/21/2001 06004.50000 41-11-04.2 N PA MD WBA994 075-51-40.7 W 0000709804 CELLCO PARTNERSHIP MOUNTAIN TOP 12/21/2001 06123.10000 41-11-04.2 N PA MD WBA994 075-51-40.7 W 0000709804 CELLCO PARTNERSHIP MOUNTAIN TOP 12/21/2001 11225.00000 41-11-04.2 N PA MD WBA994
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219394A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219394A1.txt
  • W 0000737114 COMWAVZ LIMA 01/17/2002 06315.84000 40-39-01.9 N OH NE 083-52-43.0 W 0000737115 COMWAVZ BLUFFTON 01/17/2002 06063.80000 40-56-26.3 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH NE 083-52-43.0 W 0000737115 COMWAVZ BLUFFTON 01/17/2002 06073.68000 40-56-26.3 N OH NE 083-46-04.2 W 0000737265 COMWAVZ BOWLING GREEN 01/17/2002 05984.73000 41-21-59.5 N OH NE 083-46-04.2 W 0000737265 COMWAVZ BOWLING GREEN 01/17/2002 06073.68000 41-21-59.5 N OH NE 083-46-04.2 W 0000737265 COMWAVZ BOWLING GREEN 01/17/2002 06103.33000 41-21-59.5 N OH NE 083-43-47.4 W 0000737267 COMWAVZ TOLEDO 01/17/2002 06236.77000 41-41-11.9 N OH NE 083-07-31.3 W 0000737759 COMWAVZ MARION 01/17/2002 06187.36000 40-37-48.3 N OH NE 083-07-31.3 W 0000737759
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219743A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219743A1.txt
  • LEWISTOWN 01/29/2002 00862.38750 44-05-11.3 N MD WNJW654 O 0000751375 NEXTEL COMMUNICATIONS OF THE MID-ATLANTIC, INC. 01/29/2002 00806.00000 - 00821.00000 MD WNJW654 O 0000751375 NEXTEL COMMUNICATIONS OF THE MID-ATLANTIC, INC. 01/29/2002 00819.38750 ME MD WNJW654 X 0000751375 NEXTEL COMMUNICATIONS OF THE MID-ATLANTIC, INC. 01/29/2002 00819.38750 ME MD WNJW654 069-39-20.2 W 0000751375 NEXTEL COMMUNICATIONS OF THE MID-ATLANTIC, INC. NORTH VASSALBORO 01/29/2002 00864.38750 44-29-04.2 N ME MD WNJW654 069-39-20.2 W 0000751375 NEXTEL COMMUNICATIONS OF THE MID-ATLANTIC, INC. NORTH VASSALBORO 01/29/2002 00864.38750 44-29-04.2 N MD WNNE529 A 0000751376 NEXTEL LICENSE HOLDINGS 4, INC. 01/29/2002 00806.00000 - 00821.00000 MD WNNE529 A 0000751376 NEXTEL LICENSE HOLDINGS 4, INC. 01/29/2002 00809.81250 IL MD WNNE529 088-06-50.2 W 0000751376 NEXTEL LICENSE HOLDINGS 4, INC. WHEATON 01/29/2002 00854.81250 41-51-50.1 N IL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220999A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220999A1.txt
  • MD WPNC541 082-39-05.6 W 0000803947 Westel-Milwaukee Company, LLC BETSY LAYNE 03/11/2002 02124.80000 37-33-17.4 N KY MD WPNC541 082-39-05.6 W 0000803947 Westel-Milwaukee Company, LLC BETSY LAYNE 03/11/2002 06171.87500 37-33-17.4 N KY MD WPNC542 082-32-54.9 W 0000803985 Westel-Milwaukee Company, LLC PIKEVILLE 03/11/2002 02168.40000 37-27-55.3 N KY MD WMQ379 088-19-52.2 W 0000804041 Westel-Milwaukee Company, LLC MURRAY 03/11/2002 02162.00000 36-32-58.2 N KY MD WMV845 083-57-04.2 W 0000804043 Westel-Milwaukee Company, LLC GRAY 03/11/2002 02121.60000 36-57-14.8 N KY MD WMV845 083-57-04.2 W 0000804043 Westel-Milwaukee Company, LLC GRAY 03/11/2002 02128.00000 36-57-14.8 N KY MD WMV845 083-57-04.2 W 0000804043 Westel-Milwaukee Company, LLC GRAY 03/11/2002 06315.84000 36-57-14.8 N KY MD WPNB590 082-43-19.6 W 0000804111 Westel-Milwaukee Company, LLC Louisa 03/11/2002 02162.00000 37-55-38.1 N KY MD WPNB590 082-43-19.6 W 0000804111 Westel-Milwaukee Company,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221156A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221156A1.txt
  • N IN MD KBE24 086-30-25.9 W 0000817942 PSI ENERGY INC BEDFORD 03/20/2002 06785.00000 38-52-01.1 N IN MD KBE24 086-30-25.9 W 0000817942 PSI ENERGY INC BEDFORD 03/20/2002 06825.00000 38-52-01.1 N IN MD KBE24 086-30-25.9 W 0000817942 PSI ENERGY INC BEDFORD 03/20/2002 06865.00000 38-52-01.1 N IN MD WPNA210 086-27-04.9 W 0000817943 PSI ENERGY INC MITCHELL 03/20/2002 06625.00000 38-41-16.1 N TX MD WNEF601 100-01-04.2 W 0000817995 Central Power and Light Company DBA AEP CLINE 03/20/2002 01890.00000 29-14-53.8 N TX MD WNEF601 100-01-04.2 W 0000817995 Central Power and Light Company DBA AEP CLINE 03/20/2002 06635.00000 29-14-53.8 N TX MD WNEF601 100-01-04.2 W 0000817995 Central Power and Light Company DBA AEP CLINE 03/20/2002 06675.00000 29-14-53.8 N KS MD WPSE627 101-58-13.9 W 0000819548 UNION PACIFIC RAILROAD COMPANYWESTKAN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221477A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221477A1.txt
  • 0000829295 M/A COM PRIVATE RADIO SYSTEMS, INC. WALNUT HILL 03/29/2002 06660.00000 30-51-48.8 N FL NE 083-54-58.0 W 0000829297 M/A COM PRIVATE RADIO SYSTEMS, INC. NUTALL RISE 03/29/2002 06610.00000 30-08-33.0 N Page 14 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 084-13-04.2 W 0000829299 M/A COM PRIVATE RADIO SYSTEMS, INC. CRAWFORDVILLE 03/29/2002 06770.00000 30-11-42.1 N FL NE 084-13-04.2 W 0000829299 M/A COM PRIVATE RADIO SYSTEMS, INC. CRAWFORDVILLE 03/29/2002 06780.00000 30-11-42.1 N FL NE 084-13-04.2 W 0000829299 M/A COM PRIVATE RADIO SYSTEMS, INC. CRAWFORDVILLE 03/29/2002 06810.00000 30-11-42.1 N FL NE 084-28-55.9 W 0000829300 M/A COM PRIVATE RADIO SYSTEMS, INC. SOPCHOPPY 03/29/2002 06790.00000 30-04-03.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222214A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222214A1.txt
  • Wireless Services of Hawaii, Inc. 17800.00000 AT&T Wireless Services of Hawaii, Inc. 22875.00000 Cellco Partnership dba Verizon Wireless 02174.80000 Cellco Partnership dba Verizon Wireless 06226.89000 Cellco Partnership dba Verizon Wireless 06565.00000 Cellco Partnership dba Verizon Wireless 06695.00000 AT&T Wireless Services of Hawaii, Inc. 10617.50000 AT&T Wireless Services of Hawaii, Inc. 21675.00000 AT&T Wireless Services of Hawaii, Inc. 22675.00000 OWEGO NY 42-08-04.2 N 076-14-17.7 W WHITNEY POIINT NY 42-l 6-25.0 N 075-56-06.0 W HONOLULU HI 21-18-32.6 N 157-51-37.1 w HONOLULU HI 21-18-32.6 N 157-51-37.1 w HONOLULU HI 21-I 8-32.6 N 157-51-37.1 w JUANA DIAZ PR 18-02-33.8 N 066-31-25.6 W BEAVER DAM KY 37-22-42.8 N 086-50-23.2 W BEAVER DAM KY 37-22-42.8 N 086-50-23.2 W BEAVER DAM KY 37-22-42.8 N 086-50-23.2 W BEAVER DAM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222413A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222413A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222413A1.txt
  • TELECASTING OF SIOUX CITY Requested Facility: Ch No:49 N Latitude: 42-35-12; W Longitude: 96-13-18 ERP (Average): 2.6 kW; HAAT: 77 meters; Antenna: DA Facility ID: 21160 Call Sign: KHGI-DT File No: BDSTA-20020307ACT City: KEARNEY State: NE Grant Date: 03/19/2002 Licensee Name: PAPPAS TELECASTING OF CENTRAL NEBRASKA,A CALIFORNIA LP Requested Facility: Ch No:36 N Latitude: 40-39-28; W Longitude: 98-52-4 ERP (Average): 4.2 kW; HAAT: 179 meters; Antenna: DA Facility ID: 60571 Call Sign: WMMF-DT File No: BDSTA-20020307ACU City: FOND DU LAC State: WI Grant Date: 03/19/2002 Licensee Name: PAPPAS TELECASTING OF WISCONSIN, A CALIFORNIA LTD PARTNRSHP Requested Facility: Ch No:44 N Latitude: 43-47-32; W Longitude: 88-26-14 ERP (Average): 2 kW; HAAT: -23 meters; Antenna: ND Facility ID: 68853 Call Sign: KEYC-DT File
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223320A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223320A1.txt
  • WPJE633 094-18-03.9 W 0000915877 KANSAS CITY SMSA LIMITED PARTNERSHIP HARRISONVILLE 06/06/2002 06226.89000 38-37-07.9 N MO MD WPJE633 094-18-03.9 W 0000915877 KANSAS CITY SMSA LIMITED PARTNERSHIP HARRISONVILLE 06/06/2002 06705.00000 38-37-07.9 N CA MD WLU973 120-13-37.4 W 0000916140 PACIFIC BELL TWAIN HARTE 06/06/2002 11245.00000 38-02-17.8 N CA MD WLU974 120-01-56.8 W 0000916141 PACIFIC BELL STRAWBERRY 06/06/2002 10795.00000 38-11-47.5 N MO MD WLU513 094-25-04.2 W 0000916246 KANSAS CITY SMSA LIMITED PARTNERSHIP PECULIAR 06/06/2002 05974.85000 38-43-20.4 N KS MD WPJF587 095-13-12.5 W 0000916248 MID KANSAS INC ERIE 06/06/2002 06197.24000 37-34-23.4 N KS MD WPJF587 095-13-12.5 W 0000916248 MID KANSAS INC ERIE 06/06/2002 06375.14000 37-34-23.4 N MA MD WPNE697 070-45-37.3 W 0000916317 Southwestern Bell Mobile Systems, LLC MARSHFIELD 06/06/2002 05945.20000 42-06-18.4 N MA MD WPNE697 070-45-37.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224146A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224146A1.txt
  • OF YAKIMA 07/02/2002 23525.00000 46-36-17.0 N Page 26 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 120-23-15.4 W 0000948278 YAKIMA, COUNTY OF YAKIMA 07/02/2002 23125.00000 46-35-30.8 N WA NE 120-28-34.6 W 0000948279 YAKIMA, COUNTY OF UNION GAP 07/02/2002 23325.00000 46-34-02.5 N WA NE 120-20-04.2 W 0000948775 YAKIMA, COUNTY OF MOXEE 07/02/2002 21925.00000 46-31-20.5 N WA NE 120-20-04.2 W 0000948775 YAKIMA, COUNTY OF MOXEE 07/02/2002 22125.00000 46-31-20.5 N WA NE 120-20-04.2 W 0000948775 YAKIMA, COUNTY OF MOXEE 07/02/2002 22325.00000 46-31-20.5 N MA NE 070-12-34.0 W 0000949381 TOWN OF YARMOUTH WATER DEPARTMENT YARMOUTH PORT 07/03/2002 00928.15625 41-41-28.0 N MA NE 070-12-34.0 W 0000949381 TOWN OF YARMOUTH
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224621A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224621A1.txt
  • Postal Service Express and Priority Mail. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM 097-02-41.9 W 0000926567 City of Grand Prairie Grand Prairie 07/16/2002 00122.80000 32-41-38.1 N AZ MD WPUJ954 110-56-27.7 W 0000963761 Aeronautical Radio Inc Tucson 07/16/2002 00129.30000 32-06-57.9 N CA MD WPTJ679 117-36-04.2 W 0000963770 Aeronautical Radio Inc. Ontario 07/16/2002 00129.42500 34-03-21.6 N HI NE 159-20-20.2 W 0000963916 Aeronautical Radio Inc Lihue 07/16/2002 00131.22500 21-58-33.5 N MI NE 083-44-36.0 W 0000963942 Aeronautical Radio Inc Flint 07/16/2002 00129.57500 42-57-55.8 N AZ NE 114-33-34.3 W 0000964164 Aeronautical Radio Inc Bullhead City 07/16/2002 00130.12500 35-09-26.6 N Page 1 AF - Aeronautical and Fixed State Purpose Call
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224861A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224861A1.txt
  • OF IOWA RSA #1, INC. DECATUR CITY 07/24/2002 06595.00000 40-45-31.0 N IA MD WMQ552 093-50-20.0 W 0000974027 USCOC OF IOWA RSA #1, INC. DECATUR CITY 07/24/2002 10552.50000 40-45-31.0 N WA MD WPNE374 120-14-22.2 W 0000974054 RCC Minnesota, Inc MALAGA 07/24/2002 06171.87500 47-19-09.4 N WA MD WPNE374 120-14-22.2 W 0000974054 RCC Minnesota, Inc MALAGA 07/24/2002 06725.00000 47-19-09.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 06555.00000 47-28-07.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 22725.00000 47-28-07.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 22975.00000 47-28-07.4 N IA MD WLT333 092-25-31.0 W 0000974075 WATERLOO/CEDAR FALLS CELLTELCOWATERLOO 07/24/2002 02112.00000 42-28-20.0 N IA MD WLT333 092-25-31.0 W 0000974075 WATERLOO/CEDAR FALLS CELLTELCOWATERLOO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225135A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225135A1.txt
  • OF IOWA RSA #1, INC. DECATUR CITY 07/24/2002 06595.00000 40-45-31.0 N IA MD WMQ552 093-50-20.0 W 0000974027 USCOC OF IOWA RSA #1, INC. DECATUR CITY 07/24/2002 10552.50000 40-45-31.0 N WA MD WPNE374 120-14-22.2 W 0000974054 RCC Minnesota, Inc MALAGA 07/24/2002 06171.87500 47-19-09.4 N WA MD WPNE374 120-14-22.2 W 0000974054 RCC Minnesota, Inc MALAGA 07/24/2002 06725.00000 47-19-09.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 06555.00000 47-28-07.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 22725.00000 47-28-07.4 N WA MD WPNE376 120-20-04.2 W 0000974055 RCC Minnesota, Inc WENATCHEE 07/24/2002 22975.00000 47-28-07.4 N IA MD WLT333 092-25-31.0 W 0000974075 WATERLOO/CEDAR FALLS CELLTELCOWATERLOO 07/24/2002 02112.00000 42-28-20.0 N IA MD WLT333 092-25-31.0 W 0000974075 WATERLOO/CEDAR FALLS CELLTELCOWATERLOO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225370A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225370A1.txt
  • N OR MD KOT30 123-00-17.3 W 0000987778 OREGON, STATE OF SALEM 08/06/2002 06665.00000 44-55-41.4 N OR MD WPVC280 121-06-16.2 W 0000987823 State of Oregon Maupin 08/06/2002 06585.00000 45-17-51.4 N WA MD WEG732 121-05-32.2 W 0000987839 OREGON, STATE OF DEPT. OF TRANSPORTATION WISHRAM 08/06/2002 06745.00000 45-42-24.4 N AZ MD WNEV926 111-04-53.3 W 0000989271 CENTRAL ARIZONA WATER CONSERVATION DISTRICT TUCSON 08/07/2002 10705.00000 31-58-04.2 N PA MD WPJB915 075-14-09.0 W 0000990199 BUCKS, COUNTY OF SPRINGTOWN TOWNSHIP 08/08/2002 06755.00000 40-32-46.0 N PA MD WPJB915 075-14-09.0 W 0000990199 BUCKS, COUNTY OF SPRINGTOWN TOWNSHIP 08/08/2002 10562.50000 40-32-46.0 N PA MD WNEF229 075-07-47.0 W 0000990202 BUCKS, COUNTY OF DOYLESTOWN 08/08/2002 00953.80000 40-18-43.0 N PA MD WNEF229 075-07-47.0 W 0000990202 BUCKS, COUNTY OF DOYLESTOWN 08/08/2002 06775.00000 40-18-43.0 N PA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226838A17.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226838A17.txt
  • BE TO USE... *** A DAILY NEWSPAPER *** FOR LOCAL OR NATIONAL NEWS AND CURRENT AFFAIRS? BASE: RESPONDENTS WHO USE A LOCAL WEEKLY NEWSPAPER MOST OFTEN AS THEIR SOURCE FOR LOCAL OR NATIONAL NEWS TOTAL ----- UNWEIGHTED TOTAL 61 WEIGHTED TOTAL 3955 (000) 100.0 TOP 2 BOX (%4-5) ---------------- 49.8 5 MUCH MORE LIKELY 39.2 4 10.6 3 16.1 2 4.2 1 NO MORE LIKELY 24.0 DON'T KNOW - REFUSE 5.9 MEAN 3.4 DATA BASED UPON FEWER THAN 145 RESPONDENTS DO NOT MEET MINIMUM REPORTING STANDARDS AND ARE SUPPLIED FOR INTERNAL USE ONLY. COPYRIGHT 2002 NIELSEN MEDIA RESEARCH, INC. NIELSEN MEDIA RESEARCH PAGE: 58 FCC PHONE SURVEY AUGUST 23-SEPTEMBER 1; 3-5, 2002 TABLE 056 Q11FG. USING A SCALE OF 1 TO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226838A20.doc
  • stations. As we stated in last year's report, the number of radio owners has declined by 6.7 percent from March 1996 to November 1997 (from 5,133 to 4,788 owners), by an additional 5.8 percent from November 1997 to November 1998 (from 4,788 to 4,512), by another 11.2 percent from November 1998 to March 2000 (from 4,512 to 4,006), and by 4.2 percent from March 2000 to March 2001 (from 4,006 to 3,836). As of March 2002, there were 3,408 owners of commercial radio stations across the nation, for a cumulative decline in the number of owners of 34 percent since March 1996. The decline in the number of owners reflects a general continuation of the consolidation of the commercial radio industry
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227176A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227176A1.txt
  • LA QUINTA 10/02/2002 22075.00000 33-42-57.0 N CA RM WNTW647 116-16-47.0 W 0001046390 DESERT SANDS UNIFIED SCHOOL DISTRICT LA QUINTA 10/02/2002 22175.00000 33-42-57.0 N CA RM WNTW647 116-16-47.0 W 0001046390 DESERT SANDS UNIFIED SCHOOL DISTRICT LA QUINTA 10/02/2002 22375.00000 33-42-57.0 N CA RM WNTW647 116-16-47.0 W 0001046390 DESERT SANDS UNIFIED SCHOOL DISTRICT LA QUINTA 10/02/2002 23575.00000 33-42-57.0 N CA RM WPNJ306 116-18-04.2 W 0001046624 DESERT SANDS UNIFIED SCHOOL DISTRICT INDIO 10/02/2002 22375.00000 33-40-51.0 N CA RM WPNJ307 116-16-35.3 W 0001046625 DESERT SANDS UNIFIED SCHOOL DISTRICT LA QUINTA 10/02/2002 22375.00000 33-42-09.5 N CA RM WPNJ307 116-16-35.3 W 0001046625 DESERT SANDS UNIFIED SCHOOL DISTRICT LA QUINTA 10/02/2002 23275.00000 33-42-09.5 N CA RM WPNJ308 116-12-25.8 W 0001046626 DESERT SANDS UNIFIED SCHOOL DISTRICT INDIO 10/02/2002 21925.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227409A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227409A1.txt
  • - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD WLW422 094-18-19.2 W 0001051889 MISSOURI RSA 9B1 LIMITED PARTNERSHIP BUTLER 10/08/2002 06795.00000 38-13-22.9 N MO MD WPJE633 094-18-03.9 W 0001051895 KANSAS CITY SMSA LIMITED PARTNERSHIP HARRISONVILLE 10/08/2002 06635.00000 38-37-07.9 N MO MD WLU513 094-25-04.2 W 0001052019 KANSAS CITY SMSA LIMITED PARTNERSHIP PECULIAR 10/08/2002 05945.20000 38-43-20.4 N MO MD WLS724 094-22-37.7 W 0001052028 KANSAS CITY SMSA LIMITED PARTNERSHIP LEES SUMMIT 10/08/2002 06197.24000 38-51-54.3 N UT MD WMQ926 110-20-51.6 W 0001052088 WWC Holding Co., Inc. SUNNYSIDE 10/08/2002 06256.54000 39-38-33.9 N UT MD WMQ926 110-20-51.6 W 0001052088 WWC Holding Co., Inc. SUNNYSIDE 10/08/2002 06375.14000 39-38-33.9 N UT
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228552A1.pdf
  • assignment of spectrum rights......................................................................4 2.3 Exclusive licenses...........................................................................................................5 2.4 Proper definition of interference rights...........................................................................6 2.5 Special provisions for low-power devices......................................................................7 3 Elements of an Efficient Transition to Spectrum Markets......................................................8 3.1 Speed...............................................................................................................................9 3.2 Low transaction costs......................................................................................................9 3.3 Transparency...................................................................................................................9 3.4 Liquidity........................................................................................................................10 3.5 Participation..................................................................................................................10 3.6 Simultaneity..................................................................................................................11 3.7 Package Bidding...........................................................................................................14 4 A Proposed Transition Market Mechanism: Band-Restructuring Auctions........................16 4.1 Simultaneous two-sided auction with package bidding................................................16 4.2 Voluntary participation is the quid pro quo for flexibility............................................19 4.3 An incumbent need not sell its license..........................................................................21 4.4 Efficient and fair division of auction proceeds.............................................................22 4.5 FCC conducted band restructuring auctions................................................................23 5 What Spectrum Should be Restructured?.............................................................................24 5.1 300 MHz to 3000 MHz.................................................................................................25 5.2 Eliminating difficult bands from the initial implementation........................................26 Federal government spectrum...............................................................................................28 Core TV spectrum.................................................................................................................30 Unlicensed bands..................................................................................................................30 Non-exclusively
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228691A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228691A1.txt
  • - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPOT980 088-58-02.9 W 0001092163 Cellco Partnership dba Verizon Wireless Orient 11/15/2002 06093.45000 37-54-07.9 N IL MD WPOT980 088-58-02.9 W 0001092163 Cellco Partnership dba Verizon Wireless Orient 11/15/2002 06635.00000 37-54-07.9 N VA MD WPVS789 077-14-04.2 W 0001092182 Washington/Baltimore Cellular Limited Partnership ANNANDALE 11/15/2002 05945.20000 38-49-59.5 N VA MD WPVS789 077-14-04.2 W 0001092182 Washington/Baltimore Cellular Limited Partnership ANNANDALE 11/15/2002 05974.85000 38-49-59.5 N VA MD WPVS789 077-14-04.2 W 0001092182 Washington/Baltimore Cellular Limited Partnership ANNANDALE 11/15/2002 05974.85000 38-49-59.5 N VA MD WPVS789 077-14-04.2 W 0001092182 Washington/Baltimore Cellular Limited Partnership ANNANDALE 11/15/2002 06034.15000 38-49-59.5 N VA MD WPVS789 077-14-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228932A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228932A1.txt
  • NEW BERLIN 10/31/2002 00854.76250 42-57-46.0 N TN MD WPTB986 085-30-03.0 W 0001040070 MOTIENT COMMUNICATIONS COOKEVILLE 09/25/2002 00855.83750 36-09-51.0 N MD WNQQ748 A 0001048035 MOTIENT COMMUNICATIONS 10/03/2002 00813.57500 CA MD WNQQ748 116-56-09.1 W 0001048035 MOTIENT COMMUNICATIONS SAN DIEGO 10/03/2002 00858.57500 32-41-47.2 N MD WPIB906 A 0001048038 MOTIENT COMMUNICATIONS 10/03/2002 00810.33750 IN MD WPIB906 085-35-54.9 W 0001048038 MOTIENT COMMUNICATIONS MILFORD 10/03/2002 00855.33750 39-20-04.2 N MD WPJT290 A 0001048040 MOTIENT COMMUNICATIONS 10/03/2002 00810.33750 Page 22 GB - Business, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD WPJT290 086-16-48.0 W 0001048040 MOTIENT COMMUNICATIONS INDIANAPOLIS 10/03/2002 00855.33750 39-49-36.2 N MD WNLD464 O 0001048042 MOTIENT COMMUNICATIONS 10/03/2002 00810.83750 IL MD WNLD464 089-15-36.3 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229150A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229150A1.txt
  • Co., Inc. BADGER MOUNTAIN 11/26/2002 06715.62500 39-02-54.9 N Page 8 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK NE 146-22-40.5 W 0001103635 General Communications Corp. Valdez 11/26/2002 19495.00000 61-05-22.0 N AK NE 146-23-39.9 W 0001103709 General Communication Corp. Vadez 11/26/2002 17935.00000 61-05-04.2 N PR NE 067-06-40.0 W 0001104485 Centennial Puerto Rico License Corp. Mayaguez 11/27/2002 11642.50000 18-11-05.0 N FL NE 080-16-25.4 W 0001104579 Verizon Wireless Personal Communications L.P. Jupiter 11/27/2002 06152.75000 26-54-16.0 N PR NE 067-10-52.0 W 0001104667 Centennial Puerto Rico License Corp. Cabo Rojo 11/27/2002 11137.50000 18-06-47.4 N CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229201A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229201A1.txt
  • Co., Inc. BADGER MOUNTAIN 11/26/2002 06715.62500 39-02-54.9 N Page 8 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK NE 146-22-40.5 W 0001103635 General Communications Corp. Valdez 11/26/2002 19495.00000 61-05-22.0 N AK NE 146-23-39.9 W 0001103709 General Communication Corp. Vadez 11/26/2002 17935.00000 61-05-04.2 N PR NE 067-06-40.0 W 0001104485 Centennial Puerto Rico License Corp. Mayaguez 11/27/2002 11642.50000 18-11-05.0 N FL NE 080-16-25.4 W 0001104579 Verizon Wireless Personal Communications L.P. Jupiter 11/27/2002 06152.75000 26-54-16.0 N PR NE 067-10-52.0 W 0001104667 Centennial Puerto Rico License Corp. Cabo Rojo 11/27/2002 11137.50000 18-06-47.4 N CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229376A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229376A1.txt
  • WI MD KNKQ437 091-21-47.0 W 0001108517 ACC Wisconsin License LLC IRON RIVER 12/03/2002 46-33-28.0 N WI MD KNKQ437 090-46-45.9 W 0001108517 ACC Wisconsin License LLC LaPointe 12/03/2002 46-47-08.0 N WI MD KNKQ437 090-59-27.6 W 0001108517 ACC Wisconsin License LLC WASHBURN 12/03/2002 46-41-29.7 N WI MD KNKA214 087-51-43.6 W 0001109983 MILWAUKEE SMSA LIMITED PARTNERSHIP CUDAHY 12/04/2002 42-56-24.1 N WI MD KNKA214 087-57-04.2 W 0001109983 MILWAUKEE SMSA LIMITED PARTNERSHIP GRAFTON 12/04/2002 43-20-40.6 N WI MD KNKA214 087-56-42.4 W 0001109983 MILWAUKEE SMSA LIMITED PARTNERSHIP Mequon 12/04/2002 43-12-52.0 N WI MD KNKA214 087-52-52.0 W 0001109983 MILWAUKEE SMSA LIMITED PARTNERSHIP Milwaukee 12/04/2002 43-04-33.5 N WI MD KNKA214 087-51-17.3 W 0001109983 MILWAUKEE SMSA LIMITED PARTNERSHIP PORT WASHINGTON 12/04/2002 43-26-36.0 N WI MD KNKA214 087-51-25.2 W 0001109983 MILWAUKEE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229616A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229616A1.txt
  • INC. KANNAPOLIS 12/10/2002 00855.58750 35-31-43.5 N NC MD WPCQ332 080-36-35.2 W 0001116311 NEXTEL LICENSE HOLDINGS 1, INC. KANNAPOLIS 12/10/2002 00855.58750 35-31-43.5 N MD WPHF361 A 0001116319 NEXTEL LICENSE HOLDINGS 4, INC. 12/10/2002 00806.00000 - 00821.00000 MD WPHF361 A 0001116319 NEXTEL LICENSE HOLDINGS 4, INC. 12/10/2002 00819.01250 MI MD WPHF361 083-25-28.8 W 0001116319 NEXTEL LICENSE HOLDINGS 4, INC. MONROE 12/10/2002 00864.01250 41-54-04.2 N MI MD WPHF361 083-25-28.8 W 0001116319 NEXTEL LICENSE HOLDINGS 4, INC. MONROE 12/10/2002 00864.01250 41-54-04.2 N Page 16 GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WPIX652 A 0001116321 NEXTEL LICENSE HOLDINGS 4, INC. 12/10/2002 00806.00000 - 00821.00000 MD WPIX652 A 0001116321 NEXTEL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229919A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229919A1.txt
  • 0001127129 NEXTEL OF CALIFORNIA, INC. 12/18/2002 00809.73750 MD WPAP568 A 0001127129 NEXTEL OF CALIFORNIA, INC. 12/18/2002 00854.73750 MD WPAP568 A 0001127129 NEXTEL OF CALIFORNIA, INC. 12/18/2002 00854.73750 CA MD WPAP568 118-35-04.3 W 0001127129 NEXTEL OF CALIFORNIA, INC. CHATSWORTH 12/18/2002 00854.73750 34-19-32.0 N CA MD WPAP568 118-35-04.3 W 0001127129 NEXTEL OF CALIFORNIA, INC. CHATSWORTH 12/18/2002 00854.73750 34-19-32.0 N CA MD WPAP568 117-32-04.2 W 0001127129 NEXTEL OF CALIFORNIA, INC. EL TORO 12/18/2002 00854.73750 33-42-37.1 N CA MD WPAP568 117-32-04.2 W 0001127129 NEXTEL OF CALIFORNIA, INC. EL TORO 12/18/2002 00854.73750 33-42-37.1 N CA MD WPAP568 118-14-15.3 W 0001127129 NEXTEL OF CALIFORNIA, INC. LA CRESCENTA 12/18/2002 00854.73750 34-16-06.0 N CA MD WPAP568 118-14-15.3 W 0001127129 NEXTEL OF CALIFORNIA, INC. LA CRESCENTA 12/18/2002 00854.73750 34-16-06.0 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230012A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230012A1.txt
  • Alaska Juneau 12/23/2002 18000.00000 58-17-50.8 N FL NE 081-25-21.3 W 0001133991 SEMINOLE, COUNTY OF ALTAMONTE SPRINGS 12/26/2002 06565.00000 28-40-09.0 N Page 11 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 081-20-26.2 W 0001134004 SEMINOLE, COUNTY OF SANFORD 12/26/2002 06655.00000 28-48-39.9 N FL NE 081-25-04.2 W 0001134013 SEMINOLE, COUNTY OF LONGWOOD 12/26/2002 06735.00000 28-42-05.9 N FL NE 081-25-04.2 W 0001134013 SEMINOLE, COUNTY OF LONGWOOD 12/26/2002 06815.00000 28-42-05.9 N FL NE 081-16-58.2 W 0001134021 SEMINOLE, COUNTY OF WINTER PARK 12/26/2002 06585.00000 28-38-20.0 N FL NE 081-07-31.2 W 0001134026 SEMINOLE, COUNTY OF CHULUOTA 12/26/2002 06845.00000 28-37-57.0 N FL NE 081-12-04.0 W 0001134055 SEMINOLE, COUNTY OF OVIEDO 12/26/2002
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230453A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230453A1.txt
  • to meet escalating demand for its Global Locating System. Applicant also hereby notifies the Commission of a change in its name from Eagle Eye, Inc. to SkyBitz, Inc., which did not involve a change in ownership or control of the license. SITE ID: MOBILE 100,000 half-duplex METs CONUS, Alaska, HI & surrounding US water, VARIOUS LOCATION: Eagle Eye, Inc. (ant. size:4.2cm Square) MT1 0.042 meters ANTENNA ID: Ant. Type: Patch 4.00 dBW MSK at 3600 bps; digital; data 1626.5000 - 1660.5000 MHz 4K00F1D reception of GPS L1 CA signal 1574.4200 - 1576.4200 MHz 1M00G1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K00F1D Points of Communication: MOBILE - AMSC-1 - (101.0 W.L.) MOBILE - MSAT-1 - (106.5 W.L.) Registration
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230619A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230619A1.txt
  • N MA MD WPOL890 071-45-14.3 W 0001168244 Worcester Telephone Company Lunenburg 01/22/2003 10642.50000 42-35-54.8 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA MD WPOL890 071-45-14.3 W 0001168244 Worcester Telephone Company Lunenburg 01/22/2003 11621.25000 42-35-54.8 N MA MD WPOU575 071-35-04.2 W 0001168683 CELLCO PARTNERSHIP WESTBOROUGH 01/23/2003 06256.54000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0001168683 CELLCO PARTNERSHIP WESTBOROUGH 01/23/2003 06286.19000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0001168683 CELLCO PARTNERSHIP WESTBOROUGH 01/23/2003 06345.49000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0001168683 CELLCO PARTNERSHIP WESTBOROUGH 01/23/2003 06375.14000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0001168683 CELLCO PARTNERSHIP WESTBOROUGH 01/23/2003 06404.79000 42-16-59.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232299A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232299A1.txt
  • BP - ANIK E2 - (111.1 W.L) Application for Modification 03/13/2002 - 03/13/2012 Date Effective: 03/14/2003 Class of Station: Mobile Earth Station Grant of Authority SkyBitz, Incorporated E000725 SES-MOD-20030116-00057E Nature of Service:Domestic Mobile-Satellite Service, International Mobile Satellite Service, Mobile Satellite Service SITE ID: MOBILE 100,000 half-duplex METs CONUS, Alaska, HI & surrounding US water, VARIOUS LOCATION: Eagle Eye, Inc. (ant. size:4.2cm Square) MT1 0.042 meters ANTENNA ID: Ant. Type: Patch 4.00 dBW MSK at 3600 bps; digital; data 1626.5000 - 1660.5000 MHz 4K00F1D reception of GPS L1 CA signal 1574.4200 - 1576.4200 MHz 1M00G1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K00F1D Points of Communication: MOBILE - AMSC-1 - (101.0 W.L.) MOBILE - MSAT-1 - (106.5 W.L.) Application
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232306A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232306A1.txt
  • CELLCO PARTNERSHIP WOLCOTT 03/14/2003 06375.14000 41-33-34.3 N CT MD WMK739 072-56-49.3 W 0001234864 CELLCO PARTNERSHIP WOLCOTT 03/14/2003 06404.79000 41-33-34.3 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK MD WPWY494 146-23-39.9 W 0001235146 General Communication Corp. Vadez 03/14/2003 17935.00000 61-05-04.2 N CT MD WLN866 072-40-29.2 W 0001235212 Cellco Partnership WINDSOR 03/14/2003 05945.20000 41-51-59.5 N CT MD WLN866 072-40-29.2 W 0001235212 Cellco Partnership WINDSOR 03/14/2003 06004.50000 41-51-59.5 N CT MD WLN866 072-40-29.2 W 0001235212 Cellco Partnership WINDSOR 03/14/2003 06226.89000 41-51-59.5 N CT MD WLN866 072-40-29.2 W 0001235212 Cellco Partnership WINDSOR 03/14/2003 06315.84000 41-51-59.5 N CT MD WLN866 072-40-29.2 W 0001235212 Cellco
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232514A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232514A1.txt
  • COUNTY OF, CA SAN CLEMENTE 03/13/2003 00929.23750 33-25-53.1 N CA MD WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 03/13/2003 00929.23750 33-45-03.1 N CA MD WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 03/13/2003 00929.23750 33-45-03.1 N CA MD WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 03/13/2003 00929.23750 33-45-03.1 N CA MD WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 03/13/2003 00929.23750 33-44-46.1 N CA MD WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 03/13/2003 00929.23750 33-44-46.1 N CA MD WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 03/13/2003 00929.23750 33-44-46.1 N CA MD WNMW822 117-59-13.2 W 0001233473 ORANGE, COUNTY OF, CA WESTMINSTER 03/13/2003 00929.23750 33-45-23.1 N CA MD WNMW822 117-59-13.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232868A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232868A1.txt
  • 06093.45000 41-10-51.9 N PA MD WMQ644 079-32-33.0 W 0001247559 PENNSYLVANIA RSA NO. 6 (I) LIMITED PARTNERSHIP KNOX 03/25/2003 02112.00000 41-10-54.0 N PA MD WMQ644 079-32-33.0 W 0001247559 PENNSYLVANIA RSA NO. 6 (I) LIMITED PARTNERSHIP KNOX 03/25/2003 06345.49000 41-10-54.0 N PA MD WMQ644 079-32-33.0 W 0001247559 PENNSYLVANIA RSA NO. 6 (I) LIMITED PARTNERSHIP KNOX 03/25/2003 10618.12500 41-10-54.0 N CA MD WAJ88 117-14-04.2 W 0001247560 SOUTHERN CALIFORNIA EDISON COMPANY TWIN LAKES 03/25/2003 06745.00000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0001247560 SOUTHERN CALIFORNIA EDISON COMPANY TWIN LAKES 03/25/2003 06795.00000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0001247560 SOUTHERN CALIFORNIA EDISON COMPANY TWIN LAKES 03/25/2003 06795.00000 34-13-56.0 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233268A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233268A1.txt
  • 04/08/2003 10795.00000 45-58-49.0 N FL MD WPUW264 084-28-55.9 W 0001268422 M/A-COM, INC. SOPCHOPPY 04/09/2003 06630.00000 30-04-03.6 N FL MD WPUW265 083-54-58.0 W 0001268429 M/A-COM, INC. NUTALL RISE 04/09/2003 06770.00000 30-08-33.0 N FL MD WPUW211 084-21-38.9 W 0001268439 M/A-COM, INC. WAKULLA 04/09/2003 06790.00000 30-08-09.1 N FL MD WPUW211 084-21-38.9 W 0001268439 M/A-COM, INC. WAKULLA 04/09/2003 06810.00000 30-08-09.1 N FL MD WPUW266 084-13-04.2 W 0001268456 M/A-COM, INC. CRAWFORDVILLE 04/09/2003 06610.00000 30-11-42.1 N FL MD WPUW266 084-13-04.2 W 0001268456 M/A-COM, INC. CRAWFORDVILLE 04/09/2003 06620.00000 30-11-42.1 N FL MD WPUW266 084-13-04.2 W 0001268456 M/A-COM, INC. CRAWFORDVILLE 04/09/2003 06650.00000 30-11-42.1 N FL MD WPUW266 084-13-04.2 W 0001268456 M/A-COM, INC. CRAWFORDVILLE 04/09/2003 06780.00000 30-11-42.1 N FL MD WPUE985 084-14-43.2 W 0001268467 M/A-COM, INC. TALLAHASSEE 04/09/2003 06590.00000 30-27-18.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233490A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233490A1.txt
  • COUNTY OF, CA SAN CLEMENTE 04/17/2003 00929.23750 33-25-53.1 N CA AM WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 04/17/2003 00929.23750 33-45-03.1 N CA AM WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 04/17/2003 00929.23750 33-45-03.1 N CA AM WNMW822 117-52-30.2 W 0001233473 ORANGE, COUNTY OF, CA SANTA ANA 04/17/2003 00929.23750 33-45-03.1 N CA AM WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 04/17/2003 00929.23750 33-44-46.1 N CA AM WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 04/17/2003 00929.23750 33-44-46.1 N CA AM WNMW822 117-37-04.2 W 0001233473 ORANGE, COUNTY OF, CA SILVERADO 04/17/2003 00929.23750 33-44-46.1 N CA AM WNMW822 117-59-13.2 W 0001233473 ORANGE, COUNTY OF, CA WESTMINSTER 04/17/2003 00929.23750 33-45-23.1 N CA AM WNMW822 117-59-13.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234183A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234183A1.txt
  • Technology LAKEWOOD 04/28/2003 06620.62500 40-06-07.9 N NJ MD WNEJ554 074-28-58.5 W 0001288788 OCEAN, COUNTY OF - Division of Wireless Technology NEW EGYPT 04/28/2003 06655.00000 40-04-58.4 N NJ MD WNEJ554 074-28-58.5 W 0001288788 OCEAN, COUNTY OF - Division of Wireless Technology NEW EGYPT 04/28/2003 06780.62500 40-04-58.4 N AZ MD WNEV926 111-04-53.3 W 0001290686 CENTRAL ARIZONA WATER CONSERVATION DISTRICT TUCSON 04/29/2003 11131.25000 31-58-04.2 N AZ MD WNEV925 110-59-34.5 W 0001290707 CENTRAL ARIZONA WATER CONSERVATION DISTRICT TUCSON 04/29/2003 11148.75000 31-59-59.0 N AZ MD WNEV925 110-59-34.5 W 0001290707 CENTRAL ARIZONA WATER CONSERVATION DISTRICT TUCSON 04/29/2003 19265.00000 31-59-59.0 N WA MD WPNI380 121-55-26.5 W 0001291378 PUBLIC UTILITY DISTRICT NO 1 OF SNOHOMISH COUNTY MONROE 04/29/2003 11225.00000 47-57-17.4 N WA MD WPNI380 121-55-26.5 W 0001291378 PUBLIC UTILITY
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234913A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234913A1.txt
  • Fe RaBelen 05/21/2003 06286.19000 34-39-40.2 N NM MD KFP81 106-46-03.0 W 0001318962 The Burlington Northern and Santa Fe RaBelen 05/21/2003 21825.00000 34-39-40.2 N NM MD KFP81 106-46-03.0 W 0001318962 The Burlington Northern and Santa Fe RaBelen 05/21/2003 21925.00000 34-39-40.2 N NM MD KFP81 106-46-03.0 W 0001318962 The Burlington Northern and Santa Fe RaBelen 05/21/2003 23025.00000 34-39-40.2 N IA MD WPQQ607 094-44-04.2 W 0001319572 Corn Belt Power Cooperative Glidden 05/21/2003 00932.28125 42-05-06.4 N IA MD WPQQ607 094-44-04.2 W 0001319572 Corn Belt Power Cooperative Glidden 05/21/2003 00941.28125 42-05-06.4 N IA MD WPOT627 093-16-34.5 W 0001319587 CORN BELT POWER COOPERATIVE Hampton 05/21/2003 00928.75625 42-41-12.4 N IA MD WPOT627 093-16-34.5 W 0001319587 CORN BELT POWER COOPERATIVE Hampton 05/21/2003 00952.75625 42-41-12.4 N IA MD WPQR724 092-53-23.7
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235047A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235047A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235047A1.txt
  • USA'' Media Market Ownership Shares within Medium Percent Share of Media Market % of Media % of Medium Parent Company # of Stations % Share % Share (AxBxE) Cross Ownership Column F Squared A B C D E F G H TV owner A (Voice 1) 2 25.0 8.5 Voice 1 --- Broadcast TV owner B (Voice 2) 1 12.5 4.2 17.9 Television TV owner C (Voice 3) 1 12.5 4.2 17.9 Stations TV owner D (Voice 4) 1 12.5 4.2 17.9 (8 total) TV owner E (Voice 5) 1 12.5 4.2 17.9 33.8% 100.0% TV owner F (Voice 6) 1 12.5 4.2 17.9 TV owner G (Voice 7) 1 12.5 4.2 17.9 Radio owner A (Voice 1) 3 11.5 2.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235515A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235515A1.txt
  • W 0001345016 MASSPORT AUTHORITY EAST BOSTON 06/11/2003 23125.00000 42-21-57.3 N MA NE 071-01-07.2 W 0001345016 MASSPORT AUTHORITY EAST BOSTON 06/11/2003 23425.00000 42-21-57.3 N MA NE 071-01-07.2 W 0001345016 MASSPORT AUTHORITY EAST BOSTON 06/11/2003 23575.00000 42-21-57.3 N MA NE 071-01-30.2 W 0001345020 MASSPORT AUTHORITY EAST BOSTON 06/11/2003 23175.00000 42-22-55.3 N IN NE 085-20-47.9 W 0001345200 DELAWARE, COUNTY OF Muncie 06/11/2003 06765.00000 40-17-04.2 N NV NE 119-47-33.8 W 0001345223 Nevada State Highway Patrol Reno 06/11/2003 10568.12500 39-28-24.8 N NV NE 119-40-11.6 W 0001345299 Nevada State Highway Patrol Virginia City 06/11/2003 10633.12500 39-19-10.7 N Page 33 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 076-49-31.9 W 0001346099
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235763A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235763A1.txt
  • N CA MD WLB650 120-47-33.1 W 0001351886 Corban Communications, Inc. Jackson 06/18/2003 06345.49000 38-21-06.4 N CA MD WLB650 120-47-33.1 W 0001351886 Corban Communications, Inc. Jackson 06/18/2003 06375.14000 38-21-06.4 N CA MD WLB650 120-47-33.1 W 0001351886 Corban Communications, Inc. Jackson 06/18/2003 06404.79000 38-21-06.4 N WA MD WLM236 120-25-39.2 W 0001352461 Northwest Microwave, Inc WENATCHEE 06/18/2003 11645.00000 47-16-18.4 N WA MD WLW572 120-19-04.2 W 0001352462 NORTHWEST MICROWAVE INC WENNATCHEE 06/18/2003 11155.00000 47-25-03.4 N FL MD WPJE822 084-08-06.6 W 0001352579 USCOC OF TALLAHASSEE, INC. CENTERVILLE 06/18/2003 05945.20000 30-32-46.7 N FL MD WPJE822 084-08-06.6 W 0001352579 USCOC OF TALLAHASSEE, INC. CENTERVILLE 06/18/2003 06004.50000 30-32-46.7 N FL MD WMM974 083-51-21.0 W 0001352648 FLORIDA RSA #8, INC. MONTICELLO 06/18/2003 02174.80000 30-28-31.0 N FL MD WMM974 083-51-21.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236064A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236064A1.txt
  • N WI MD WPOS848 088-01-24.0 W 0001362756 UNITED STATES CELLULAR OPERATINPLYMOUTH 06/25/2003 06585.00000 43-46-45.0 N WI MD WPOS848 088-01-24.0 W 0001362756 UNITED STATES CELLULAR OPERATINPLYMOUTH 06/25/2003 06600.00000 43-46-45.0 N WI MD WPOS848 088-01-24.0 W 0001362756 UNITED STATES CELLULAR OPERATINPLYMOUTH 06/25/2003 06605.00000 43-46-45.0 N CA MD KVB31 117-22-10.1 W 0001364139 SOUTHERN CALIFORNIA EDISON COMHESPERIA 06/26/2003 05945.20000 34-22-04.0 N CA MD WAJ88 117-14-04.2 W 0001364153 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 06/26/2003 06197.24000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0001364153 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 06/26/2003 06795.00000 34-13-56.0 N CA NE 115-32-20.9 W 0001358676 WWC LICENSE L.L.C. Brawley 06/23/2003 06660.62500 32-58-48.1 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237174A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237174A1.txt
  • CROOK 07/21/2003 06345.49000 40-45-51.1 N CO MD WLU677 102-42-43.4 W 0001388707 Corban Communications, Inc. CROOK 07/21/2003 06404.79000 40-45-51.1 N RI MD WML652 071-18-25.2 W 0001388880 CELLCO PARTNERSHIP NEWPORT 07/21/2003 10568.12500 41-29-51.4 N CA MD WPJC983 117-07-14.1 W 0001389391 Verizon Wireless (VAW) LLC SAN DIEGO 07/22/2003 10627.50000 32-48-55.2 N PA MD WLW362 075-43-59.6 W 0001389424 NORTHEAST PENNSYLVANIA SMSA LIMAVOCA 07/22/2003 11285.00000 41-20-04.2 N CA MD WLM376 117-06-56.1 W 0001389468 Verizon Wireless (VAW) LLC SAN DIEGO 07/22/2003 10562.50000 32-58-52.2 N AZ MD WMR833 111-39-07.5 W 0001389564 CNG Communications, Inc. COOLIDGE 07/22/2003 06226.89000 32-57-31.4 N AZ MD WMR833 111-39-07.5 W 0001389564 CNG Communications, Inc. COOLIDGE 07/22/2003 06226.89000 32-57-31.4 N AZ MD WMR833 111-39-07.5 W 0001389564 CNG Communications, Inc. COOLIDGE 07/22/2003 06286.19000 32-57-31.4 N AZ
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237354A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237354A1.txt
  • City TX MD WLK533 097-10-28.4 W 0001401713 Corban Communications, Inc. Smithville 07/31/2003 06063.80000 30-05-17.3 N TX MD WLK533 097-10-28.4 W 0001401713 Corban Communications, Inc. Smithville 07/31/2003 06093.45000 30-05-17.3 N TX MD WLK533 097-10-28.4 W 0001401713 Corban Communications, Inc. Smithville 07/31/2003 06123.10000 30-05-17.3 N TX MD WLK533 097-10-28.4 W 0001401713 Corban Communications, Inc. Smithville 07/31/2003 06152.75000 30-05-17.3 N MD MD WPTI527 077-24-04.2 W 0001401880 Cellco Partnership Frederick 07/31/2003 06286.19000 39-25-17.5 N MD MD WPTI527 077-24-04.2 W 0001401880 Cellco Partnership Frederick 07/31/2003 06345.49000 39-25-17.5 N MD MD WPTI527 077-24-04.2 W 0001401880 Cellco Partnership Frederick 07/31/2003 06404.79000 39-25-17.5 N CA MD WPOM431 124-11-30.5 W 0001401915 California Rural Service Area #1, Inc. CRESCENT CITY 08/01/2003 06585.00000 41-45-19.7 N CA MD WPOM431 124-11-30.5 W 0001401915 California
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238406A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238406A1.txt
  • W 0001424042 ROADRUNNER CINGULAR LICENSE SUROOSEVELT 08/20/2003 05945.20000 30-27-32.6 N TX NE 100-07-58.9 W 0001424042 ROADRUNNER CINGULAR LICENSE SUROOSEVELT 08/20/2003 06004.50000 30-27-32.6 N TX NE 100-24-14.2 W 0001424050 ROADRUNNER CINGULAR LICENSE SUSONORA 08/20/2003 06197.24000 30-30-04.8 N TX NE 100-24-14.2 W 0001424050 ROADRUNNER CINGULAR LICENSE SUSONORA 08/20/2003 06256.54000 30-30-04.8 N TX NE 099-52-00.8 W 0001424059 ROADRUNNER CINGULAR LICENSE SUKIMBLE 08/20/2003 06197.24000 30-32-04.2 N TX NE 099-52-00.8 W 0001424059 ROADRUNNER CINGULAR LICENSE SUKIMBLE 08/20/2003 06286.19000 30-32-04.2 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT NE 111-39-56.7 W 0001424507 Questar Infocomm Incorporated Provo 08/20/2003 17845.00000 40-14-50.8 N TX NE 099-35-30.5 W 0001424515
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238830A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238830A1.txt
  • Bell Mobile Systems, LLCFresno 09/02/2003 19595.00000 36-31-55.7 N CA NE 119-59-52.1 W 0001437349 SOUTHWESTERN BELL MOBILE SYSTEHURON 09/02/2003 19545.00000 36-14-40.7 N CA NE 122-35-03.0 W 0001437390 Southwestern Bell Mobile Systems, LLCYreka 09/02/2003 19385.00000 41-47-37.7 N CA NE 121-13-28.3 W 0001437424 SOUTHWESTERN BELL MOBILE SYSTEMANTECA 09/02/2003 17835.00000 37-48-04.4 N CA NE 120-28-58.0 W 0001438066 SOUTHWESTERN BELL MOBILE SYSTEEL NIDO 09/03/2003 10556.25000 37-08-04.2 N NV NE 119-56-39.1 W 0001438115 Southwestern Bell Mobile Systems, LLCIncline Village 09/03/2003 19465.00000 39-19-23.7 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV NE 119-53-04.1 W 0001438272 Southwestern Bell Mobile Systems, LLCIncline Village 09/03/2003 17905.00000 39-18-48.2 N ND
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239292A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239292A1.pdf
  • also respond to reports of unlit towers. The FAA also routinely notifies Commission field offices when owners fail to report that lights have been repaired. On July 25, 2002, an agent from the Detroit Office conducted an inspection of the antenna structure located on Webb Ridge Road 0.14 miles east of the intersection of Webb Ridge Road and KY-59, approximately 4.2 miles northwest of Olive Hill, Kentucky. The agent observed no ASR number posted at the site. A search of Commission records and subsequent contacts with FrontierVision revealed that the antenna structure was subject to Part 17 of the Rules, was not registered, and accordingly, needed to be registered. On July 26, 2002, an agent from the Detroit Office conducted an
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239429A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239429A1.txt
  • 09/25/2003 00948.12500 33-07-24.4 N VT NE 072-58-30.0 W 0001462816 VOX VERMONT, L.L.C. Rutland 09/25/2003 00945.00000 - 00945.25000 43-36-07.0 N ME NE 070-00-35.0 W 0001463475 MAINE PUBLIC BROADCASTING CORPLITCHFIELD 09/25/2003 00950.00000 44-09-15.0 N LA NE 091-09-50.0 W 0001464123 CITADEL BROADCASTING COMPANYZachary 09/25/2003 00946.00000 30-37-24.0 N AR NE 094-33-49.3 W 0001464400 JOHN BROWN UNIVERSITY Siloam Springs 09/26/2003 00947.50000 36-11-22.6 N WI NE 088-35-04.2 W 0001465210 CUMULUS LICENSING CORP. Oshkosh 09/26/2003 00950.00000 44-00-50.4 N PA NE 080-05-07.0 W 0001465332 NM LICENSING, LLC Erie 09/26/2003 00944.35000 - 00944.65000 42-07-39.0 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD KGA476 079-20-25.0 W 0001460668 Schuylkill Mobile Fone, Inc. CLARION 09/23/2003 00157.89000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239684A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239684A1.txt
  • Business Services Co. Vealmoor 10/03/2003 00956.28125 32-32-02.0 N AK NE 149-26-01.5 W 0001472882 ACS of Anchorage License Sub, Inc. Wasilla 10/03/2003 19390.00000 61-34-55.9 N AK NE 149-39-22.0 W 0001472908 ACS of Anchorage License Sub, Inc. Meadow Lakes 10/03/2003 17830.00000 61-34-36.4 N AK NE 149-39-22.0 W 0001472908 ACS of Anchorage License Sub, Inc. Meadow Lakes 10/03/2003 17890.00000 61-34-36.4 N AK NE 149-18-04.2 W 0001472938 ACS of Anchorage License Sub, Inc. Mantanuska 10/03/2003 17830.00000 61-33-45.6 N AK NE 149-18-04.2 W 0001472938 ACS of Anchorage License Sub, Inc. Mantanuska 10/03/2003 17890.00000 61-33-45.6 N AK NE 149-18-04.2 W 0001472938 ACS of Anchorage License Sub, Inc. Mantanuska 10/03/2003 17950.00000 61-33-45.6 N Page 33 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240202A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240202A1.txt
  • Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA MD WPNC379 078-31-01.0 W 0001481318 STU-COMM, INC. CHARLOTTESVILLE 10/14/2003 00946.50000 38-02-44.2 N KY MD WPON252 085-54-59.8 W 0001481331 HART COUNTY COMMUNICATIONS, INCHorse Cave 10/14/2003 00947.50000 37-10-00.1 N KY MD WPON253 085-51-47.1 W 0001481420 HART COUNTY COMMUNICATIONS, INCHorse Cave 10/14/2003 00949.87500 37-11-04.2 N NV MD WPNF699 119-48-31.7 W 0001482019 NM LICENSING, LLC Reno 10/14/2003 00945.00000 39-31-38.7 N MO MD WGV758 094-47-35.0 W 0001482174 EAGLE RADIO, INC ST JOSEPH 10/14/2003 00951.50000 39-46-46.0 N OR MD WLP545 123-21-51.0 W 0001482222 BROOKE COMMUNICATIONS, INC. ROSEBURG 10/14/2003 00951.82500 43-12-23.0 N CA MD WLD427 119-17-53.0 W 0001482283 BUCKLEY BROADCASTING CORPORATVISALIA 10/14/2003 00951.50000 36-19-12.0 N OR MD WMF723
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240203A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240203A1.txt
  • 0001485064 AT&T Wireless Services of Florida, Inc. CRESTVIEW 10/16/2003 06375.14000 30-44-16.6 N FL MD WLT430 086-33-38.8 W 0001485064 AT&T Wireless Services of Florida, Inc. CRESTVIEW 10/16/2003 06375.14000 30-44-16.6 N FL MD WLT430 086-33-38.8 W 0001485064 AT&T Wireless Services of Florida, Inc. CRESTVIEW 10/16/2003 06404.79000 30-44-16.6 N CA MD WLT476 117-01-23.1 W 0001485092 Verizon Wireless (VAW) LLC CHULA VISTA 10/16/2003 18125.00000 32-37-04.2 N CA MD WLV761 116-56-14.0 W 0001485162 Verizon Wireless (VAW) LLC SAN DIEGO 10/16/2003 10663.75000 32-41-50.0 N FL MD WMW244 086-12-57.7 W 0001485169 AT&T Wireless PCS, LLC DEFUNIAK SPRING 10/16/2003 06197.24000 30-47-14.6 N FL MD WMW244 086-12-57.7 W 0001485169 AT&T Wireless PCS, LLC DEFUNIAK SPRING 10/16/2003 06226.89000 30-47-14.6 N FL MD WMW244 086-12-57.7 W 0001485169 AT&T Wireless PCS, LLC DEFUNIAK
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240204A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240204A1.txt
  • 06256.54000 30-34-16.0 N FL MD WPJB352 084-35-27.0 W 0001485699 AT&T Wireless PCS, LLC QUINCY 10/16/2003 06286.19000 30-34-16.0 N FL MD WPJB352 084-35-27.0 W 0001485699 AT&T Wireless PCS, LLC QUINCY 10/16/2003 06315.84000 30-34-16.0 N FL MD WPJB352 084-35-27.0 W 0001485699 AT&T Wireless PCS, LLC QUINCY 10/16/2003 06345.49000 30-34-16.0 N PA MD WLW362 075-43-59.6 W 0001486465 NORTHEAST PENNSYLVANIA SMSA LIMAVOCA 10/17/2003 11445.00000 41-20-04.2 N PA MD WPXI505 075-45-52.9 W 0001486471 Northeast Pennsylvania SMSA Limited PaPittston 10/17/2003 10955.00000 41-19-11.4 N CA MD WPWN787 115-31-34.1 W 0001486477 Cellco Partnership Brawley 10/17/2003 06155.83900 33-00-28.4 N FL MD WPSE456 084-27-21.9 W 0001486526 AT&T Wireless PCS, LLC MIDWAY 10/17/2003 05945.20000 30-30-15.6 N FL MD WPSE456 084-27-21.9 W 0001486526 AT&T Wireless PCS, LLC MIDWAY 10/17/2003 05974.85000 30-30-15.6 N FL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240461A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240461A1.txt
  • of KANGLEY 10/21/2003 06675.00000 47-20-10.3 N WA NE 121-51-30.4 W 0001489531 King, County of KANGLEY 10/21/2003 06825.00000 47-20-10.3 N CA NE 115-57-44.7 W 0001490337 San Diego, County of Salton Sea 10/21/2003 00954.75000 33-16-45.0 N TN NE 086-52-10.0 W 0001491160 TENNESSEE STATE DEPT OF CORRECNashville 10/22/2003 00953.55000 36-10-34.2 N TN NE 086-53-57.0 W 0001491175 TENNESSEE STATE DEPT OF CORRECNASHVILLE 10/22/2003 00957.15000 36-11-04.2 N CA NE 115-30-34.7 W 0001492081 San Diego, County of Brawley 10/22/2003 06795.00000 32-58-28.5 N WA NE 124-19-58.3 W 0001492629 WASHINGTON STATE, OF QUEETS 10/23/2003 06256.54000 47-33-09.1 N WA NE 124-19-58.3 W 0001492629 WASHINGTON STATE, OF QUEETS 10/23/2003 06315.84000 47-33-09.1 N CA NE 118-25-39.3 W 0001494894 KERN, COUNTY OF KERNVILLE 10/24/2003 19350.00000 35-46-13.6 N WA NE 122-54-40.4 W 0001494913 WASHINGTON,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240772A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240772A1.txt
  • Date Effective: 11/03/2003 Class of Station: Fixed Earth Stations Grant of Authority 11/11/2003 - 11/11/2018 Renewal Nature of Service:Domestic Fixed Satellite Service 35 ° 51 ' 12.00 " N LAT. SITE ID: 1 WAKE, RALEIGH, NC 78 ° 38 ' 26.00 " W LONG. LOCATION: HUGHES SRA-501-6-C 1 6 meters ANTENNA ID: 3700.0000 - 4200.0000 MHz 36000F9 PICO SATELLITE 2 4.2 meters ANTENNA ID: SAR-14 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) WQED MULTIMEDIA E940139 SES-RWL-20031020-01435E Date Effective: 10/31/2003 Class of Station: Fixed Earth Stations Grant of Authority 12/21/2003 - 12/21/2018 Renewal Nature of Service:Domestic Fixed Satellite Service Page 10 of 16 40 ° 26 ' 47.00 " N LAT. SITE ID: 1 4802 FIFTH
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240774A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240774A1.txt
  • Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 122-20-55.4 W 0001499390 UNION PACIFIC RAILROAD COMPANYTACOMA 10/29/2003 00941.38125 47-15-48.3 N WA NE 122-14-55.4 W 0001499443 UNION PACIFIC RAILROAD COMPANYSUMNER 10/29/2003 00932.30625 47-12-14.4 N WA NE 122-14-55.4 W 0001499443 UNION PACIFIC RAILROAD COMPANYSUMNER 10/29/2003 00941.30625 47-12-14.4 N MA NE 071-04-04.2 W 0001500181 Partners Healthcare Boston 10/29/2003 21275.00000 42-21-56.4 N MA NE 071-04-33.9 W 0001500231 Partners Healthcare Medford 10/29/2003 22475.00000 42-24-23.6 N AZ NE 112-05-15.3 W 0001501096 Black Mountain LLC Phoenix 10/30/2003 19640.00000 33-34-40.0 N AZ NE 112-04-24.1 W 0001501145 Black Mountain Broadband, LLC Phoenix 10/30/2003 18080.00000 33-27-04.8 N IN NE P 087-42-55.0 W 0001501850 GERMAN TOWNSHIP WATER DISTRICTEVANSVILLE 10/27/2003 00956.35625
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241079A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241079A1.txt
  • 00952.04375 42-01-33.0 N NE NE 098-19-37.1 W 0001506501 CITY OF ISLAND GRAND ISLAND 11/05/2003 00928.63125 40-55-22.6 N NE NE 098-19-37.1 W 0001506501 CITY OF ISLAND GRAND ISLAND 11/05/2003 00952.63125 40-55-22.6 N MD NE 076-57-48.0 W 0001507013 WASHINGTON SUBURBAN SANITARY CSilver Spring 11/05/2003 06735.00000 39-02-59.0 N MD NE 077-12-22.0 W 0001507018 WASHINGTON SUBURBAN SANITARY CDAMASCUS 11/05/2003 06565.00000 39-17-10.0 N NV NE 119-19-04.2 W 0001508564 CC COMMUNICATIONS FERNLEY 11/06/2003 06256.54000 39-29-12.0 N NV NE 118-46-36.1 W 0001508633 CC COMMUNICATIONS FALLON 11/06/2003 06004.50000 39-28-31.6 N RP - Broadcast Auxiliary Remote Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD KEI434 A 0001507917 INFINITY BROADCASTING OPERATION 11/06/2003 00450.08750 MD KEI434 A 0001507917 INFINITY BROADCASTING OPERATION
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241381A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241381A1.txt
  • MD WNTP688 120-24-27.7 W 0001514338 SACRAMENTO MUNICIPAL UTILITY DISFRESH POND 11/13/2003 06256.54000 38-50-31.7 N CA MD WNTP688 120-24-27.7 W 0001514338 SACRAMENTO MUNICIPAL UTILITY DISFRESH POND 11/13/2003 06404.79000 38-50-31.7 N CA MD WNTK330 121-20-56.8 W 0001514344 SACRAMENTO MUNICIPAL UTILITY DISSACRAMENTO 11/13/2003 06256.54000 38-41-34.7 N CA MD WNTK330 121-20-56.8 W 0001514344 SACRAMENTO MUNICIPAL UTILITY DISSACRAMENTO 11/13/2003 06375.14000 38-41-34.7 N CA MD WQU79 120-41-04.2 W 0001514366 SACRAMENTO MUNICIPAL UTILITY DISCAMINO 11/13/2003 06123.10000 38-49-24.2 N CA MD WQU79 120-41-04.2 W 0001514366 SACRAMENTO MUNICIPAL UTILITY DISCAMINO 11/13/2003 06152.75000 38-49-24.2 N CA MD WQU79 120-41-04.2 W 0001514366 SACRAMENTO MUNICIPAL UTILITY DISCAMINO 11/13/2003 06760.00000 38-49-24.2 N CA MD WQU79 120-41-04.2 W 0001514366 SACRAMENTO MUNICIPAL UTILITY DISCAMINO 11/13/2003 06800.00000 38-49-24.2 N CA MD WQU79 120-41-04.2 W 0001514366 SACRAMENTO MUNICIPAL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241673A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241673A1.txt
  • Puerto Rico License Corp. Hucares 11/21/2003 06556.25000 18-11-45.0 N PR MD WPQL337 065-41-57.0 W 0001523444 Centennial Puerto Rico License Corp. Hucares 11/21/2003 06590.00000 18-11-45.0 N PR MD WPQL337 065-41-57.0 W 0001523444 Centennial Puerto Rico License Corp. Hucares 11/21/2003 06645.00000 18-11-45.0 N PR MD WPQL337 065-41-57.0 W 0001523444 Centennial Puerto Rico License Corp. Hucares 11/21/2003 11667.50000 18-11-45.0 N MA MD WHF578 071-02-04.2 W 0001523787 CELLCO PARTNERSHIP QUINCY 11/21/2003 10632.50000 42-16-51.4 N NH MD WPON731 071-26-19.7 W 0001523870 Cellco Partnership Manchester 11/21/2003 06197.24000 43-00-00.1 N NH MD WPON731 071-26-19.7 W 0001523870 Cellco Partnership Manchester 11/21/2003 06226.89000 43-00-00.1 N NH MD WPON731 071-26-19.7 W 0001523870 Cellco Partnership Manchester 11/21/2003 06256.54000 43-00-00.1 N NH MD WPON731 071-26-19.7 W 0001523870 Cellco Partnership Manchester 11/21/2003 06345.49000 43-00-00.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242039A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242039A1.txt
  • MD KKQ56 092-08-54.4 W 0001531645 ENTERGY SERVICES INC WEST MONROE 12/02/2003 06635.00000 32-31-00.5 N LA MD KKQ56 092-08-54.4 W 0001531645 ENTERGY SERVICES INC WEST MONROE 12/02/2003 06665.00000 32-31-00.5 N CA MD WNTX919 117-40-33.2 W 0001532693 The Boeing Company WRIGHTWOOD 12/02/2003 06735.00000 34-21-08.0 N OR MD KJO38 123-07-17.4 W 0001532946 UNION PACIFIC RAILROAD COMPANYSalem 12/03/2003 06855.62500 44-51-15.4 N OR MD KJO34 123-06-04.2 W 0001533095 UNION PACIFIC RAILROAD COMPANYALBANY 12/03/2003 06695.62500 44-37-47.8 N AZ MD WNEO852 112-13-01.0 W 0001533523 Salt River Project Agricultural ImprovemenPEORIA 12/03/2003 00928.38125 33-33-16.3 N AZ MD WNEO852 112-13-01.0 W 0001533523 Salt River Project Agricultural ImprovemenPEORIA 12/03/2003 00952.38125 33-33-16.3 N CA MD WNTH667 117-53-09.2 W 0001534120 The Boeing Company EDWARDS AFB 12/03/2003 06545.00000 34-55-29.9 N CA MD KMW36 121-28-16.8 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242291A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242291A1.txt
  • 1.5 meters ANTENNA ID: SNG60/140DT TELEVISION, DATA MCPC 3700.0000 - 4200.0000 MHz 36M0G7W 60.30 dBW TELEVISION, DATA MCPC 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) SKYVIEW SATELLITE NETWORKS E990348 SES-MOD-20031023-01462E Class of Station: Fixed Earth Stations Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to add a new C-band, transmit/receive earth station 4.2 Meter antenna to their existing Ku-band FCC license (Call Sign: E990248). Page 12 of 31 33 ° 36 ' 48.20 " N LAT. SITE ID: 1 14605 N. AIRPORT DR., MARICOPA, SCOTTSDALE, AZ 111 ° 55 ' 1.00 " W LONG. LOCATION: ANDERSEN MANUFACTURING C-BAND 4.2 meters ANTENNA ID: 4P14-C 50.80 dBW DIGITAL AUDIO AND DATA 6321.5000 - 6425.0000 MHz
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242298A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242298A1.txt
  • Inc. Pullman 12/10/2003 19360.00000 46-44-48.0 N WA NE 117-11-48.4 W 0001541544 RCC Minnesota, Inc. Pullman 12/10/2003 17800.00000 46-43-58.2 N PR NE 066-00-10.6 W 0001541563 SprintCom, Inc. (Puerto Rico) BELLO HORIZONTE 12/10/2003 19655.00000 18-23-40.4 N CA NE 122-50-26.6 W 0001541823 O'Reilly and Associates Sebastopol 12/10/2003 22175.00000 38-24-41.5 N AZ NE 112-03-43.7 W 0001541841 VERIZON WIRELESS (VAW) LLC - DESEPHOENIX 12/10/2003 19630.00000 33-20-04.2 N CA NE 122-45-05.6 W 0001541881 OReilly and Associates Santa Rosa 12/10/2003 23375.00000 38-25-08.6 N AZ NE 112-05-13.0 W 0001542154 VERIZON WIRELESS (VAW) LLC - DESEPHOENIX 12/11/2003 18070.00000 33-17-26.5 N AL NE 086-39-44.4 W 0001542337 Powertel, Inc. Chelsea 12/11/2003 19330.00000 33-23-44.9 N AL NE 086-39-44.4 W 0001542337 Powertel, Inc. Chelsea 12/11/2003 19410.00000 33-23-44.9 N AL NE 086-39-47.2 W 0001542369 Powertel,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242397A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242397A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242397A1.txt
  • from other carriers. The remainder of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 27% more unbundled network element (UNE) loops with switching to unaffiliated carriers at the end of June 2003 than they reported six months earlier (13.0 million compared to 10.2 million) and about 1% fewer UNE loops without switching (about 4.2 million compared to 4.3 million). At least one CLEC was serving local telephone service end-user customers in 73% of the nation's zip codes at the end of June 2003, up from 67% a year earlier. About 95% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242553A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242553A1.txt
  • LLC CHAPIN 12/19/2003 06256.54000 39-46-06.0 N IL MD WMR270 090-23-51.0 W 0001551979 USCOC OF ILLINOIS RSA #4, LLC CHAPIN 12/19/2003 06585.00000 39-46-06.0 N IL MD WMR270 090-23-51.0 W 0001551979 USCOC OF ILLINOIS RSA #4, LLC CHAPIN 12/19/2003 06605.00000 39-46-06.0 N IL MD WMR270 090-23-51.0 W 0001551979 USCOC OF ILLINOIS RSA #4, LLC CHAPIN 12/19/2003 06665.00000 39-46-06.0 N NC MD WPNL439 082-37-04.2 W 0001552030 NORTH CAROLINA RSA #4, INC. ETOWAH 12/19/2003 06421.25000 35-20-07.9 N NC MD WPNL439 082-37-04.2 W 0001552030 NORTH CAROLINA RSA #4, INC. ETOWAH 12/19/2003 06820.00000 35-20-07.9 N NC MD WPTT664 082-32-38.5 W 0001552037 North Carolina RSA #4, Inc. Hendersonville 12/19/2003 06660.00000 35-16-53.4 N CA MD WLL850 121-47-21.0 W 0001552184 GTE MOBILNET OF CALIFORNIA LIMITEMONTEREY 12/19/2003 10577.50000 36-33-09.0 N Page
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242874A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242874A1.txt
  • Latitude City IL AM 089-49-49.0 W 0001562059 Centurion Investments, Inc., d/b/a AVMATMascoutah 01/09/2004 00122.95000 38-33-26.0 N IL AM 089-49-49.0 W 0001562059 Centurion Investments, Inc., d/b/a AVMATMascoutah 01/09/2004 00122.95000 38-33-26.0 N IL AM 089-49-49.0 W 0001562059 Centurion Investments, Inc., d/b/a AVMATMascoutah 01/09/2004 00122.97500 38-33-26.0 N PA MD KYM5 079-59-59.2 W 0001574331 FINLEYVILLE AIRPORT INC FINLEYVILLE 01/09/2004 00123.00000 40-14-00.3 N KS NE 097-13-04.2 W 0001569484 Midwest Corporate Aviation, Inc. Wichita 01/06/2004 00122.70000 37-44-08.0 N CA NE 117-07-42.0 W 0001571255 Ovation Air Group Murrieta 01/07/2004 00122.70000 33-34-36.0 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH NE 083-59-41.0 W 0001573094 Greene County Regional Airport AuthorityXenia 01/08/2004 00121.72500
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243069A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243069A1.txt
  • W 0001576393 Florida Cellular Service, LLC MIAMI 01/12/2004 25-51-12.7 N NV MD KNKR319 115-45-03.1 W 0001578955 WUE, Inc. Alamo 01/13/2004 37-38-39.8 N NV MD KNKR319 114-28-02.0 W 0001578955 WUE, Inc. Caliente 01/13/2004 37-27-32.9 N FL MD WPSJ791 080-34-29.2 W 0001579133 Commnet of Florida LLC. Islamorada-33036 01/13/2004 24-57-35.4 N SD MD KNKN446 102-41-34.6 W 0001581030 WWC License L.L.C. Pine Ridge 01/14/2004 43-31-04.2 N NJ MD KNKA382 074-59-38.4 W 0001581095 Southwestern Bell Mobile Systems, LLCMonroe Twp. 01/14/2004 39-40-53.1 N NJ MD KNKA382 074-59-38.4 W 0001581095 Southwestern Bell Mobile Systems, LLCMonroe Twp. 01/14/2004 39-40-53.1 N FL MD KNKA225 080-26-23.2 W 0001582003 Florida Cellular Service, LLC HOMESTEAD 01/15/2004 25-22-54.4 N FL MD KNKA225 080-49-10.7 W 0001582003 Florida Cellular Service, LLC Miccosukee Indian R 01/15/2004 25-45-43.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243419A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243419A1.txt
  • modified for that satellite. Tweener satellites may continue in use until replaced by satellites meeting the new rules for 4.5 degree spacing and may continue in service even beyond that point. The earliest implementation of reduced orbital spacing with the final rules Will occur only when all present BSS space systems, designed to meet the existing BSS rules, have expired 4.2 EMISSION LIMITATIONS. The eirp of any Tweener satellite to be implemented in the near term must be limited so as not to cause unacceptable interference to the existing BSS satellites, including those BSS satellites of other administrations. Such a limitation could be in the fonn of a PFD limitation, similar to that specified for the Ka band FSS. See 47
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243420A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243420A1.txt
  • Oct. 26, 2001); EchoStar Satellite Corporation, 17 FCC Rcd 894, 897, n.21 (Int'l Bur., Jan. 16,2002). 16 17 The same procedures apply regardless of whether the modification proposed by an Administration is "to modify the characteristics of any of its frequency assignments" or "to include in the Region 2 Plan a new frequency assignment." ITU Radio Regulations, Appendix 30, Section 4.2. l(a),(b). In fact, to SES AMERICOM's knowledge, no U.S. BSS modification to the Plan has actually modified any original U.S. Plan assignments. Instead, the modifications have been filed as new frequency assignments, in addition to the original U.S. Plan assignments at the same location. As such, all of the U.S. modifications are the same, from the ITU's point of view,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243431A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243431A1.txt
  • protect the broadcasting- With respect to 5 4.1.1 c) of Article 4, an administration in Region 2 shall be considered as being affected if the proposed new or modified assignment in the Regions 1 and 3 List would result in exceeding the power flux-densities given below, at any test point in the service area affected. With respect to $4.2.3 a), 4.2.3 b) or 4.2.3fl of Article 4, as appropriate, an administration in Region 1 or 3 shall be considered as being affected ifthe proposed modffication to the Region 2 Plan would result in exceeding the power flux-densities given below, at any test point in the service area affected: -147 dB(K/(m2 -27MHz)) for 0' 5 t9 ~0.44' -1 38 + 25 log
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243526A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243526A1.txt
  • AZ MD WPY27 110-11-17.4 W 0001597041 Navajo Communications Company, Inc. DILKON 01/28/2004 06404.79000 35-28-15.0 N CA MD WPOT934 117-34-01.1 W 0001597083 SOUTHERN CALIFORNIA EDISON COMONTARIO 01/28/2004 06315.84000 34-00-31.0 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WAJ88 117-14-04.2 W 0001597105 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/28/2004 06063.80000 34-13-56.0 N WY MD WPNG892 106-23-10.1 W 0001597347 UNION TELEPHONE COMPANY INC HANNA 01/28/2004 11305.00000 42-09-03.9 N WY MD WPNG892 106-23-10.1 W 0001597347 UNION TELEPHONE COMPANY INC HANNA 01/28/2004 11385.00000 42-09-03.9 N WY MD WPNG892 106-23-10.1 W 0001597347 UNION TELEPHONE COMPANY INC HANNA 01/28/2004 11425.00000 42-09-03.9 N WY MD WPNG892 106-23-10.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244523A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244523A1.pdf
  • was this item needs further development and explanation. ``Perhaps an EOC pool feed would be acceptable'' ``Miami pool coordinator for Hurricanes seems to work'' ``Perhaps joint media participation in conference calls to coordinate press planning would be a step in this direction'' ``Single point of contact means single point of failure'' The existing industry pool process should be referenced. Commentary: 4.2, 4.2.1, and 4.2.2 The objective was generally supported, but some ambivalence was noted, apparently on resources implied with media taking primary responsibility for ``assuring flow in multiple languages and to persons with disabilities.'' We then asked about the public - private partnership concepts described in our Interim Report of May,''03. in particular, we gauged the participants regarding: Pre-planned media activities
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244534A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244534A1.txt
  • SPB-196 Proposal to Permit Reducing Orbital Spacings ) Between U.S. Direct Broadcast Satellites ) DA03-3903 ERRATA Pegasus Development Corporation hereby submits this errata to correct errors contained in the Technical Appendix submitted with its Comments in this proceeding.' Attached as Exhibit A is a complete, corrected copy of the Technical Appendix. Specifically, Pegasus replaces paragraphs six and seven of section 4.2, page A-4 of the Technical Appendix as follows: If the interference from all Tweeners results in an adjacent satellite C/I = 25.66 dB, then the CNR, using the above parameters, is reduced from 9.17 to 9.07 dB, a 0.1 dB degradation (the allowance for rain in this link is 3.7 dB). This corresponds to a single Tweener PFD of -135.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244558A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244558A1.txt
  • N CO AM WCX553 103-13-26.1 W 0001483372 ARNOLD BROADCASTING CO., INC. STERLING 02/24/2004 00949.87500 40-37-29.6 N CO AM WCX553 103-13-26.1 W 0001483372 ARNOLD BROADCASTING CO., INC. STERLING 02/24/2004 00950.12500 40-37-29.6 N AR AM 091-41-08.0 W 0001483379 SEARCY BROADCASTING, INC. Searcy 02/25/2004 00948.75000 35-13-26.0 N AZ AM 113-53-10.8 W 0001483514 CAMERON BROADCASTING, INC. Kingman 02/25/2004 00951.00000 35-06-40.0 N CA AM WGI245 124-12-04.2 W 0001483602 BICOASTAL MEDIA LLC EUREKA 02/23/2004 00950.50000 40-44-31.4 N TX AM 098-26-11.0 W 0001484643 TICHENOR LICENSE CORPORATION SAN ANTONIO 02/27/2004 00947.87500 29-31-01.8 N TX AM 098-26-11.0 W 0001484643 TICHENOR LICENSE CORPORATION SAN ANTONIO 02/27/2004 00947.87500 29-31-01.8 N TX AM 098-26-11.0 W 0001484643 TICHENOR LICENSE CORPORATION SAN ANTONIO 02/27/2004 00948.12500 29-31-01.8 N TX AM 098-26-11.0 W 0001484643 TICHENOR LICENSE CORPORATION
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244685A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244685A1.txt
  • protect the broadcasting- With respect to 5 4.1.1 c) of Article 4, an administration in Region 2 shall be considered as being affected if the proposed new or modified assignment in the Regions 1 and 3 List would result in exceeding the power flux-densities given below, at any test point in the service area affected. With respect to $4.2.3 a), 4.2.3 b) or 4.2.3fl of Article 4, as appropriate, an administration in Region 1 or 3 shall be considered as being affected ifthe proposed modffication to the Region 2 Plan would result in exceeding the power flux-densities given below, at any test point in the service area affected: -147 dB(K/(m2 -27MHz)) for 0' 5 t9 ~0.44' -1 38 + 25 log
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244753A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244753A1.txt
  • (99.0 W.L.) TF TR 1.8M - SPACEWAY2 - (101.0 W.L.) TF TR 1.8M - SPACEWAY3 - (103 W.L.) SKYVIEW SATELLITE NETWORKS E990348 SES-MOD-20031023-01462E Date Effective: 03/04/2004 Class of Station: Fixed Earth Stations Grant of Authority 10/13/1999 - 10/13/2009 Application for Modification Nature of Service:Domestic Fixed Satellite Service Page 10 of 19 "MOD" to add a new C-band, transmit/receive earth station 4.2 Meter antenna to their existing Ku-band FCC license (Call Sign: E990248). 33 ° 36 ' 48.20 " N LAT. SITE ID: 1 14605 N. AIRPORT DR., MARICOPA, SCOTTSDALE, AZ 111 ° 55 ' 1.00 " W LONG. LOCATION: ANDERSEN MANUFACTURING C-BAND 4.2 meters ANTENNA ID: 4P14-C 50.80 dBW DIGITAL AUDIO AND DATA 6321.5000 - 6425.0000 MHz 230KG7W 50.80 dBW DIGITAL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245058A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245058A1.txt
  • Hinton 03/10/2004 38-28-50.3 N GB - Business, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WPPZ630 A 0001644892 MOTIENT COMMUNICATIONS 03/08/2004 00810.83750 IL MD WPPZ630 087-54-50.3 W 0001644892 MOTIENT COMMUNICATIONS BUFFALO GROVE 03/08/2004 00855.83750 42-09-15.1 N MD WPQK788 A 0001644893 MOTIENT COMMUNICATIONS 03/08/2004 00810.83750 IL MD WPQK788 087-53-04.2 W 0001644893 MOTIENT COMMUNICATIONS ROSEMONT 03/08/2004 00855.83750 41-59-58.1 N MD WPSM560 A 0001644894 MOTIENT COMMUNICATIONS 03/08/2004 00810.83750 IN MD WPSM560 087-28-45.1 W 0001644894 MOTIENT COMMUNICATIONS HAMMOND 03/08/2004 00855.83750 41-35-49.1 N MD WPPY809 A 0001644895 MOTIENT COMMUNICATIONS 03/08/2004 00810.83750 MA MD WPPY809 071-00-16.2 W 0001644895 MOTIENT COMMUNICATIONS BRAINTREE 03/08/2004 00855.83750 42-12-42.4 N MD WPSM714 A 0001644896 MOTIENT COMMUNICATIONS 03/08/2004 00810.83750 FL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245582A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245582A1.txt
  • 124-07-36.2 W 0001670685 Verizon West Coast, Inc. TRINIDAD 03/25/2004 06286.19000 41-05-57.4 N CA MD WLC855 124-07-36.2 W 0001670685 Verizon West Coast, Inc. TRINIDAD 03/25/2004 06315.84000 41-05-57.4 N CA MD WLC855 124-07-36.2 W 0001670685 Verizon West Coast, Inc. TRINIDAD 03/25/2004 06404.79000 41-05-57.4 N CA MD WLC855 124-07-36.2 W 0001670685 Verizon West Coast, Inc. TRINIDAD 03/25/2004 06404.79000 41-05-57.4 N CA MD KML50 124-05-04.2 W 0001670686 Verizon West Coast, Inc. ORICK 03/25/2004 05945.20000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0001670686 Verizon West Coast, Inc. ORICK 03/25/2004 05945.20000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0001670686 Verizon West Coast, Inc. ORICK 03/25/2004 06004.50000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0001670686 Verizon West Coast, Inc. ORICK 03/25/2004 06004.50000 41-16-49.4 N CA MD KML50 124-05-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246301A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246301A1.txt
  • NE 078-58-24.4 W 0001696066 NTELOS LICENSES INC FORT DEFIANCE 04/07/2004 02608.00000 - 02614.00000 38-15-18.3 N VA NE 078-58-24.4 W 0001696066 NTELOS LICENSES INC FORT DEFIANCE 04/07/2004 02620.00000 - 02626.00000 38-15-18.3 N VA NE 078-58-24.4 W 0001696066 NTELOS LICENSES INC FORT DEFIANCE 04/07/2004 02632.00000 - 02638.00000 38-15-18.3 N VA NE 079-09-06.9 W 0001697606 NTELOS LICENSES INC CHURCHVILLE 04/07/2004 02608.00000 - 02614.00000 38-13-04.2 N VA NE 079-09-06.9 W 0001697606 NTELOS LICENSES INC CHURCHVILLE 04/07/2004 02620.00000 - 02626.00000 38-13-04.2 N VA NE 079-09-06.9 W 0001697606 NTELOS LICENSES INC CHURCHVILLE 04/07/2004 02632.00000 - 02638.00000 38-13-04.2 N Page 24 MD - Multipoint Distribution Service (MDS and MMDS) State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246534A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246534A1.txt
  • 0001701415 LOS ANGELES SMSA LIMITED PARTNEHUNTINGTON BEA 04/19/2004 10568.75000 33-41-59.0 N CA MD WLL764 121-55-21.0 W 0001701450 GTE MOBILNET OF CALIFORNIA LIMITESUNOL 04/19/2004 06197.24000 37-37-12.0 N CA MD WLL764 121-55-21.0 W 0001701450 GTE MOBILNET OF CALIFORNIA LIMITESUNOL 04/19/2004 06345.49000 37-37-12.0 N CA MD WPJA594 118-03-44.1 W 0001701460 LOS ANGELES SMSA LIMITED PARTNESEAL BEACH 04/19/2004 10571.25000 33-46-29.4 N CA MD WPOR717 118-00-04.2 W 0001701647 LOS ANGELES SMSA LIMITED PARTNEWESTMINSTER 04/19/2004 19525.00000 33-44-46.0 N CA MD WPJB569 117-09-48.1 W 0001701844 Los Angeles SMSA LIMITED PARTNERSMORENO VALLEY 04/19/2004 10626.25000 33-56-27.0 N CA MD WMR315 117-20-33.1 W 0001701911 LOS ANGELES SMSA LIMITED PARTNERIVERSIDE 04/19/2004 10628.75000 33-53-18.0 N CA MD WLV355 118-01-41.2 W 0001702763 LOS ANGELES SMSA LIMITED PARTNEHUNTINGTON BEA 04/19/2004 18120.00000 33-44-00.0 N KY MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246891A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246891A1.txt
  • 04/26/2004 00946.50000 38-01-27.0 N FL MD WGR700 082-32-15.3 W 0001711400 INFINITY BROADCASTING CORPORATITAMPA 04/26/2004 00949.50000 27-56-51.0 N PA MD WLO846 077-48-20.9 W 0001714524 M. BELMONT VERSTANDIG, INC. UPTON 04/27/2004 00945.50000 39-48-34.3 N PA MD WPWH291 077-42-37.0 W 0001714552 HJV LIMITED PARTNERSHIP Greencastle 04/27/2004 00944.50000 39-47-00.0 N FL MD WPNB889 081-51-18.3 W 0001714560 AVE MARIA UNIVERSITY, INC. Fort Meyers 04/27/2004 00945.50000 26-39-04.2 N CA MD WGR812 122-23-58.9 W 0001715515 INFINITY BROADCASTING EAST INC. SAN FRANCISCO 04/28/2004 00949.50000 37-47-40.7 N PA MD WPNH632 076-49-16.8 W 0001715639 SUNBURY BROADCASTING CORPORASELINSGROVE 04/28/2004 00950.00000 40-52-46.3 N OK NE 095-57-49.0 W 0001714553 KCD ENTERPRISES, INC. Bartlesville 04/27/2004 00951.75000 36-45-03.0 N TN NE 087-20-06.1 W 0001715059 LAKEWOOD COMMUNICATIONS LLC Lawrenceburg 04/27/2004 00945.00000 35-14-46.3 N NY NE 073-46-23.4 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247090A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247090A1.txt
  • 36-17-56.3 N TN MD WLR432 084-15-59.7 W 0001721764 Tennessee RSA No. 3 Limited Partnership d/b/a Eloqui Wireless CARYVILLE 05/03/2004 06315.84000 36-17-56.3 N TN MD WLR432 084-15-59.7 W 0001721764 Tennessee RSA No. 3 Limited Partnership d/b/a Eloqui Wireless CARYVILLE 05/03/2004 06377.61000 36-17-56.3 N TN MD WLS695 085-24-26.9 W 0001721790 Tennessee RSA No. 3 Limited Partnership d/b/a Eloqui Wireless PARRAGON 05/03/2004 02171.60000 36-11-04.2 N TN MD WLS695 085-24-26.9 W 0001721790 Tennessee RSA No. 3 Limited Partnership d/b/a Eloqui Wireless PARRAGON 05/03/2004 06197.24000 36-11-04.2 N TX MD WQR78 097-45-56.2 W 0001721845 CENTRAL TELEPHONE COMPANY OF TEXAS INC Sunset 05/03/2004 06226.89000 33-27-18.8 N TX MD WQR78 097-45-56.2 W 0001721845 CENTRAL TELEPHONE COMPANY OF TEXAS INC Sunset 05/03/2004 06256.50000 33-27-18.8 N TX MD WQR78 097-45-56.2 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247368A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247368A1.txt
  • Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC MD WHF562 082-26-11.4 W 0001732443 NORTH CAROLINA RSA #4, INC. EAST FLAT ROCK 05/11/2004 06645.00000 35-14-34.4 N NC MD WHF562 082-26-11.4 W 0001732443 NORTH CAROLINA RSA #4, INC. EAST FLAT ROCK 05/11/2004 10618.12500 35-14-34.4 N NC MD WPNL439 082-37-04.2 W 0001732533 NORTH CAROLINA RSA #4, INC. ETOWAH 05/11/2004 06805.00000 35-20-07.9 N NC MD WPNL439 082-37-04.2 W 0001732533 NORTH CAROLINA RSA #4, INC. ETOWAH 05/11/2004 06820.00000 35-20-07.9 N PR MD WPSL905 066-04-09.9 W 0001732545 SprintCom, Inc. (Puerto Rico) HATO REY 05/11/2004 19425.00000 18-25-12.5 N PR MD WPSL905 066-04-09.9 W 0001732545 SprintCom, Inc. (Puerto Rico) HATO REY 05/11/2004 19605.00000 18-25-12.5 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247633A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247633A1.txt
  • Aeronautical Radio Inc Memphis 05/18/2004 00130.60000 35-02-32.7 N TX NE 099-10-31.1 W 0001741193 City Of Hondo Hondo 05/18/2004 00122.72500 29-21-20.8 N ME NE 069-00-39.0 W 0001743958 Belfast, City of Belfast 05/20/2004 00122.80000 44-24-36.0 N AZ NE 114-39-56.8 W 0001745057 SALTZER FAMILY TRUST SOMERTON 05/10/2004 00123.00000 32-36-32.0 N IN RM KYP3 084-50-05.9 W 0001745044 RICHMOND BOARD OF AVIATION COMRICHMOND 05/07/2004 00122.70000 39-45-04.2 N RO KGX6 0001741868 ONEIDA, COUNTY OF 05/19/2004 RO KWK5 0001742237 AERODYNAMICS OF READING INC 05/19/2004 RO KAO5 0001742586 Sterling Helicopter 05/19/2004 RO KBA5 0001742635 AERONAUTICAL RADIO INC 05/19/2004 RO KCC6 0001742637 AERONAUTICAL RADIO INC 05/19/2004 RO KCL7 0001742638 AERONAUTICAL RADIO INC 05/19/2004 RO KEA5 0001742639 AERONAUTICAL RADIO INC 05/19/2004 RO KEQ7 0001742640 AERONAUTICAL RADIO INC 05/19/2004 RO KFC6 0001742641
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248147A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248147A1.txt
  • that the EIRP Density for the 115KG7W emission, transmitting on frequencies 5925.0-6310.0 MHz should be corrected from 3.80 to 33.80 dBW/4 kHz per e-mail request letter dated June 3, 2004. 33 ° 36 ' 48.20 " N LAT. SITE ID: 1 14605 N. AIRPORT DR., MARICOPA, SCOTTSDALE, AZ 111 ° 55 ' 1.00 " W LONG. LOCATION: ANDERSEN MANUFACTURING C-BAND 4.2 meters ANTENNA ID: 4P14-C 50.80 dBW DIGITAL AUDIO AND DATA 6321.5000 - 6425.0000 MHz 230KG7W 50.80 dBW DIGITAL AUDIO AND DATA 5925.0000 - 6310.0000 MHz 230KG7W 48.40 dBW DIGITAL AUDIO AND DATA 6321.5000 - 6425.0000 MHz 115KG7W 48.40 dBW DIGITAL AUDIO AND DATA 5925.0000 - 6310.0000 MHz 115KG7W DIGITAL AUDIO AND DATA 3700.0000 - 4200.0000 MHz 230KG7W DIGITAL AUDIO AND
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248567A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248567A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248567A1.txt
  • 23% of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 16% more unbundled network element (UNE) loops with switching to unaffiliated carriers at the end of December 2003 than they reported six months earlier (15.2 million compared to 13.0 million) and about 1% more UNE loops without switching (about 4.3 million compared to 4.2 million). At least one CLEC was serving local telephone service end-user customers in 75% of the nation's zip codes at the end of December 2003, up from 69% a year earlier. About 96% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico. As additional information becomes
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248658A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248658A1.txt
  • PCS, LLC Compass Lake 06/14/2004 06745.00000 30-36-33.7 N FL MD WMV854 085-29-41.0 W 0001770353 AT&T Wireless PCS, LLC CHIPLEY 06/14/2004 06585.00000 30-45-37.0 N OH MD WLW671 082-12-38.0 W 0001771592 New Par LOUDONVILLE 06/14/2004 06315.84000 40-36-38.0 N OH MD WLW671 082-12-38.0 W 0001771592 New Par LOUDONVILLE 06/14/2004 06375.14000 40-36-38.0 N OH MD WLW668 082-17-33.5 W 0001771928 New Par ASHLAND 06/14/2004 06123.10000 40-50-04.2 N HI MD WPTX374 155-27-12.0 W 0001771934 AT&T Wireless Services of Hawaii, Inc. HUMUULA 06/14/2004 06760.62500 19-43-05.0 N HI MD WPJF456 155-02-40.0 W 0001771943 AT&T Wireless Services of Hawaii, Inc. KEAAU 06/14/2004 06063.80000 19-38-13.0 N HI MD WPJF456 155-02-40.0 W 0001771943 AT&T Wireless Services of Hawaii, Inc. KEAAU 06/14/2004 06545.00000 19-38-13.0 N HI MD WPJF456 155-02-40.0 W 0001771943 AT&T Wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249262A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249262A1.txt
  • 4.0 1964 62.9 13.6 14.6 17.2 58.0 138.1 166.3 4,615 3.6 1965 78.2 15.9 20.2 21.3 50.6 150.1 186.2 5,092 3.7 1966 100.1 17.6 29.0 27.3 49.7 177.2 223.7 5,843 3.8 1967 114.2 15.1 31.3 33.7 49.8 197.7 244.0 6,375 3.8 1968 126.9 15.4 36.6 44.3 50.5 221.8 273.8 7,126 3.8 1969 172.0 16.8 45.4 56.0 53.8 281.8 344.0 8,232 4.2 1970 196.6 15.5 49.9 63.1 53.1 312.8 378.2 8,956 4.2 1971 237.4 12.7 52.0 72.5 49.2 359.1 423.8 9,962 4.3 1972 291.8 14.2 57.7 88.3 44.8 424.9 496.9 11,323 4.4 1973 364.9 15.1 62.8 115.0 47.7 527.6 605.5 13,126 4.6 1974 428.7 12.9 64.1 142.7 52.3 623.7 700.8 14,582 4.8 1975 490.2 13.2 69.2 163.4 42.5 696.1 778.5 16,098 4.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249632A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249632A1.txt
  • 082-59-42.6 W 0001796650 New Par COLUMBUS 07/06/2004 11215.00000 39-58-06.2 N OH MD WLM216 082-59-42.6 W 0001796650 New Par COLUMBUS 07/06/2004 11465.00000 39-58-06.2 N OH MD WPON328 082-15-45.0 W 0001796657 New Par Danville 07/06/2004 05974.85000 40-23-55.0 N OH MD WPON328 082-15-45.0 W 0001796657 New Par Danville 07/06/2004 06590.00000 40-23-55.0 N OH MD WPOP919 082-27-39.0 W 0001796688 New Par UTICA 07/06/2004 06226.89000 40-13-04.2 N OH MD WPOP919 082-27-39.0 W 0001796688 New Par UTICA 07/06/2004 06256.54000 40-13-04.2 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD WPOP919 082-27-39.0 W 0001796688 New Par UTICA 07/06/2004 06315.84000 40-13-04.2 N OH MD WMR791 083-53-34.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250384A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250384A1.txt
  • VoIP Growth, 2001-2002 Source: Telegeography 2004 200% 160% 95% 50% 0% 50% 100% 150% 200% 250% Africa Latin America Asia Europe Federal Communications Commission Federal Communications Commission 55 Top 10 destinations for US-originated VoIP traffic Sources: Telegeography 2004, FCC Trends Int'l Teleom 2004 2 1.9 1.8 4.3 4.1 3.5 2.9 3.2 5.8 18.3 0.4 0.4 0.4 0.8 1 1 2.2 4.2 6.3 13.8 0 2 4 6 8 10 12 14 16 18 20 Russia Thailand Peru Poland China Colombia Brazil India Philippines Mexico % total outgoing VoIP minutes % total outgoing PSTN minutes VoIP VoIPtraffic between the United States and traffic between the United States and other countries other countries Federal Communications Commission Federal Communications Commission 66 International International Fora
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250614A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250614A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250614A1.txt
  • rise to the level of serious coverage. When they appear in programming, it's usually in caricature. And they are often ignored even in the advertising that is selected. I believe that diversity of viewpoint diminishes as diversity of ownership and diversity in management jobs diminish. People of color make up over 30 percent of our population, yet they own only 4.2 per cent of the nation's radio stations and around 1.5 per cent of TV stations. The numbers of minorities have dropped across the board-owners, general managers, news directors and the news workforce. That's not right. America's strength is its diversity. America will succeed in the Twenty-first century not in spite of our diversity, but because of our diversity. We must
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250835A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250835A1.txt
  • Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD WMW552 097-31-30.2 W 0001829774 ENTERCOM WICHITA LICENSE, LLC Colwich 08/04/2004 00950.00000 37-48-00.7 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WGI245 124-12-04.2 W 0001702666 BICOASTAL MEDIA LLC EUREKA 08/03/2004 00950.50000 40-44-31.4 N GA AM WMG420 081-05-14.0 W 0001783950 THOROUGHBRED COMMUNICATIONS, INC. Savannah 08/06/2004 00945.37500 - 00945.62500 32-02-29.0 N GA AM WMG420 081-05-14.0 W 0001783950 THOROUGHBRED COMMUNICATIONS, INC. Savannah 08/06/2004 00945.37500 32-02-29.0 N GA AM WMG420 081-05-14.0 W 0001783950 THOROUGHBRED COMMUNICATIONS, INC. Savannah 08/06/2004 00945.62500 32-02-29.0 N WV AM 081-01-54.8 W 0001790757 THE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251059A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251059A1.txt
  • of Meza 08/13/2004 18080.00000 33-21-47.4 N AZ NE 111-56-29.3 W 0001840253 Tempe, City of Meza 08/13/2004 18120.00000 33-21-47.4 N AZ NE 111-57-10.5 W 0001840254 Tempe, City of Meza 08/13/2004 19680.00000 33-20-27.2 N AZ NE 111-53-42.0 W 0001840255 Tempe, City of Meza 08/13/2004 19320.00000 33-21-32.0 N AZ NE 111-53-42.0 W 0001840255 Tempe, City of Meza 08/13/2004 19640.00000 33-21-32.0 N TX NE 096-55-04.2 W 0001840256 Carrollton, City of Carrollton 08/13/2004 19620.00000 32-56-55.9 N TX NE 096-54-37.8 W 0001840257 Carrollton, City of Carrollton 08/13/2004 18060.00000 33-01-23.0 N CA NE 119-42-25.0 W 0001840264 Fresno, County of FRESNO 08/13/2004 00957.15000 36-45-32.0 N CA NE 119-44-48.5 W 0001840305 Fresno, County of Fresno 08/13/2004 00953.55000 36-43-33.8 N RP - Broadcast Auxiliary Remote Pickup State Purpose Call Sign Longitude
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251886A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251886A1.txt
  • 105-02-19.9 W 0001859409 Verizon Wireless (VAW) LLC WESTMINSTER 09/01/2004 18000.00000 39-49-34.9 N CO MD WLC477 105-02-19.9 W 0001859409 Verizon Wireless (VAW) LLC WESTMINSTER 09/01/2004 18655.00000 39-49-34.9 N CO MD WLC477 105-02-19.9 W 0001859409 Verizon Wireless (VAW) LLC WESTMINSTER 09/01/2004 18705.00000 39-49-34.9 N CO MD WHT971 104-48-27.9 W 0001859584 Verizon Wireless (VAW) LLC AURORA 09/01/2004 10642.50000 39-44-51.9 N ME MD WLT574 070-18-04.2 W 0001859615 PORTLAND CELLULAR PARTNERSHIPGray 09/01/2004 02112.00000 43-51-03.8 N ME MD WLT574 070-18-04.2 W 0001859615 PORTLAND CELLULAR PARTNERSHIPGray 09/01/2004 02115.20000 43-51-03.8 N ME MD WLT574 070-18-04.2 W 0001859615 PORTLAND CELLULAR PARTNERSHIPGray 09/01/2004 02121.60000 43-51-03.8 N ME MD WLT574 070-18-04.2 W 0001859615 PORTLAND CELLULAR PARTNERSHIPGray 09/01/2004 06256.54000 43-51-03.8 N ME MD WLT574 070-18-04.2 W 0001859615 PORTLAND CELLULAR PARTNERSHIPGray 09/01/2004 06315.84000 43-51-03.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252160A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252160A1.txt
  • Partnership Portland 09/09/2004 11265.00000 43-42-21.6 N ME NE 070-18-38.6 W 0001865775 Portland Cellular Partnership Portland 09/09/2004 11345.00000 43-42-21.6 N ME NE 070-18-38.6 W 0001865775 Portland Cellular Partnership Portland 09/09/2004 11565.00000 43-42-21.6 N ME NE 070-19-13.7 W 0001865944 Portland Cellular Partnership Falmouth 09/09/2004 10775.00000 43-45-28.2 N ME NE 070-19-13.7 W 0001865944 Portland Cellular Partnership Falmouth 09/09/2004 10855.00000 43-45-28.2 N NE NE 103-06-04.2 W 0001867161 N.E. Colorado Wireless Technologies, Inc.Bonner 09/10/2004 05945.20000 41-52-54.2 N NE NE 103-06-04.2 W 0001867161 N.E. Colorado Wireless Technologies, Inc.Bonner 09/10/2004 06004.50000 41-52-54.2 N NE NE 102-52-02.2 W 0001867162 N.E. Colorado Wireless Technologies, Inc.Alliance 09/10/2004 06197.24000 42-05-48.5 N NE NE 103-19-13.5 W 0001867163 N.E. Colorado Wireless Technologies, Inc.Bayard 09/10/2004 06256.54000 41-45-39.6 N NE NE 103-19-13.5 W 0001867163 N.E. Colorado
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252367A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252367A1.txt
  • 093-33-25.8 W 0001867038 USCOC OF GREATER IOWA, INC. Carlisle 09/17/2004 06226.89000 41-27-17.0 N IA AM WPTM655 093-33-25.8 W 0001867038 USCOC OF GREATER IOWA, INC. Carlisle 09/17/2004 06785.00000 41-27-17.0 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC MD WLT728 079-49-04.2 W 0001868593 Cellco Partnership LAKE CITY 09/13/2004 02118.40000 33-55-41.5 N SC MD WLT728 079-49-04.2 W 0001868593 Cellco Partnership LAKE CITY 09/13/2004 05974.85000 33-55-41.5 N SC MD WLT728 079-49-04.2 W 0001868593 Cellco Partnership LAKE CITY 09/13/2004 06004.50000 33-55-41.5 N VA MD WMN641 078-43-46.0 W 0001868694 CHARLOTTESVILLE CELLULAR PARTNBATESVILLE 09/13/2004 02168.40000 37-57-02.5 N VA MD WMN641 078-43-46.0 W 0001868694 CHARLOTTESVILLE CELLULAR PARTNBATESVILLE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252663A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252663A1.txt
  • 078-52-21.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-53-05.2 N NY RM KNKA203 078-48-53.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-53-18.2 N NY RM KNKA203 078-48-53.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-53-18.2 N NY RM KNKA203 078-48-53.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-53-18.2 N NY RM KNKA203 078-51-41.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-55-04.2 N NY RM KNKA203 078-51-41.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-55-04.2 N NY RM KNKA203 078-51-41.1 W 0001879244 Upstate Cellular Network BUFFALO 09/22/2004 42-55-04.2 N NY RM KNKA203 078-52-48.1 W 0001879244 Upstate Cellular Network Cambria 09/22/2004 43-09-58.5 N NY RM KNKA203 078-52-48.1 W 0001879244 Upstate Cellular Network Cambria 09/22/2004 43-09-58.5 N NY RM KNKA203 078-52-48.1 W 0001879244 Upstate
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253072A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253072A1.txt
  • overnight delivery service other than U.S. Postal Service Express and Priority Mail. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC AM 078-55-42.0 W 0001882906 Aeronautical Radio Inc Myrtle Beach 10/04/2004 00136.85000 33-40-47.1 N VT RM WQJ3 072-36-50.4 W 0001894842 VERMONT, STATE OF MORRISVILLE 10/07/2004 00135.07500 44-32-04.2 N RO WIO4 0001891812 MCGREGOR, CITY OF 10/05/2004 RO KBT2 0001893529 AERONAUTICAL RADIO INC 10/06/2004 RO KDN4 0001893530 AERONAUTICAL RADIO INC 10/06/2004 RO KKS8 0001893531 AERONAUTICAL RADIO INC 10/06/2004 Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO KKT2 0001893532 AERONAUTICAL RADIO INC 10/06/2004
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253617A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253617A1.txt
  • Thomas 10/20/2004 06625.00000 18-21-24.9 N VI AM 064-58-12.0 W 0001887781 TROPICAL SHIPPING St. Thomas 10/20/2004 11325.00000 18-21-24.9 N TN AM WNTQ411 086-40-08.9 W 0001890410 METRO GOVERNMENT OF NASHVILLENashville 10/18/2004 00928.55625 36-10-30.5 N TN AM WNTQ411 086-40-08.9 W 0001890410 METRO GOVERNMENT OF NASHVILLENashville 10/18/2004 00952.55625 36-10-30.5 N SC AM 080-23-02.9 W 0001907611 South Carolina Electric & Gas, CompanyHolly Hill 10/22/2004 00928.25625 33-20-04.2 N SC AM 080-23-02.9 W 0001907611 South Carolina Electric & Gas, CompanyHolly Hill 10/22/2004 00928.61875 33-20-04.2 N Page 13 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC AM 080-23-02.9 W 0001907611 South Carolina Electric & Gas, CompanyHolly Hill 10/22/2004 00952.25625 33-20-04.2 N SC AM 080-23-02.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253937A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253937A1.txt
  • 33-49-10.3 N CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AL MD KNKN716 088-07-44.3 W 0001914048 RCC Minnesota, Inc. Sulligent 10/26/2004 33-53-25.3 N AL MD KNKQ345 088-07-44.3 W 0001914491 RCC Minnesota, Inc. Sulligent 10/27/2004 33-53-25.3 N KY MD KNKN830 088-38-04.8 W 0001915007 BellSouth Personal Communications, LLCPADUCAH HOSPITA 10/27/2004 37-04-04.2 N FL MD KNKA264 080-03-50.9 W 0001915114 Florida Cellular Service, LLC Lake Park 10/27/2004 26-47-56.3 N KS MD KNKN677 097-01-49.0 W 0001917332 WWC License L.L.C. Arkansas City 10/28/2004 37-01-41.0 N KS MD KNKN677 097-33-48.3 W 0001917332 WWC License L.L.C. Halstead 10/28/2004 38-01-34.2 N KS MD KNKN677 097-48-38.9 W 0001917332 WWC License L.L.C. Haven 10/28/2004 37-55-42.6 N KS MD KNKN677 098-01-43.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254343A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254343A1.txt
  • State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY AM WHM22 078-47-05.1 W 0001848208 ENTERCOM BUFFALO LICENSE, LLC Amherst 11/12/2004 00944.12500 42-59-20.2 N NY AM WHM22 078-47-05.1 W 0001848208 ENTERCOM BUFFALO LICENSE, LLC Amherst 11/12/2004 00947.37500 42-59-20.2 N FL MD WJN21 081-51-18.3 W 0001928384 MERIDIAN BROADCASTING, INC. Ft. Myers 11/09/2004 00944.50000 26-39-04.2 N FL MD WPOP968 081-51-18.3 W 0001928400 MERIDIAN BROADCASTING, INC. FT Myers 11/09/2004 00949.00000 26-39-04.2 N TX MD WPNI507 101-52-08.4 W 0001928676 JMJ BROADCASTING COMPANY INC.AMARILLO 11/09/2004 00950.50000 35-11-47.0 N ME MD WLE670 070-48-01.0 W 0001928678 FNX BROADCASTING L.L.C. SANFORD 11/09/2004 00949.00000 43-25-08.0 N CA MD WJI27 121-27-53.8 W 0001929627 INFINITY RADIO INC. SACRAMENTO 11/10/2004 00950.00000 38-35-57.7 N CA MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-255779A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-255779A1.txt
  • WLV469 106-22-03.7 W 0001835050 ALLTEL Communications of the SouthwesEL PASO 12/22/2004 11035.00000 31-47-47.5 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM WLV469 106-22-03.7 W 0001835050 ALLTEL Communications of the SouthwesEL PASO 12/22/2004 18965.00000 31-47-47.5 N NE AM 103-06-04.2 W 0001867161 N.E. Colorado Wireless Technologies, IncBonner 12/23/2004 05945.20000 41-52-54.2 N NE AM 103-06-04.2 W 0001867161 N.E. Colorado Wireless Technologies, IncBonner 12/23/2004 06004.50000 41-52-54.2 N NE AM 102-52-02.2 W 0001867162 N.E. Colorado Wireless Technologies, IncAlliance 12/23/2004 06197.24000 42-05-48.5 N CA AM 117-30-10.3 W 0001939202 SOUTHWESTERN BELL MOBILE SYSTEFONTANA 12/22/2004 17935.00000 34-01-27.8 N CA AM 117-45-41.3 W 0001951313 SOUTHWESTERN BELL MOBILE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256011A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256011A1.txt
  • CALIFORNIA, INC. 01/03/2005 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WPJW432 101-52-58.0 W 0001994059 LUBBOCK RADIO PAGING SERVICE, INLUBBOCK 01/05/2005 00152.48000 33-29-11.0 N TX MD WPJW432 101-53-31.6 W 0001994059 LUBBOCK RADIO PAGING SERVICE, INLUBBOCK 01/05/2005 00152.48000 33-35-19.6 N FL MD WNPO819 087-20-04.2 W 0001997091 METROCALL USA INC. MCDAVID 01/07/2005 00152.48000 30-52-15.1 N WI NE P 089-51-50.0 W 0001994966 YMCA Family Camp Nawakwa Lac du Flambeau 01/05/2005 00464.76250 46-02-00.4 N Page 27 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 077-39-56.1 W 0001995124 MID ATLANTIC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256084A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256084A1.pdf
  • Page Executive Summary 3 Section 1.0 Introduction 5 1.1 NeuStar's Petition 5 1.2 FCC/NANC Assignment 6 1.3 Scope 6 Section 2.0 NANC's Existing Oversight Requirement 7 Section 3.0 Neutrality 7 3.1 History i.e. LM transfer to NeuStar 7 3.2 Existing Requirements 8 3.3 Publicly Traded Company 11 3.4 Private Company 12 Section 4.0 Enforcement Tools 13 4.1 Audit Requirement 13 4.2 Penalties 13 4.3 Oversight Controls 14 Section 5.0 Summary and Recommendation 14 Section 6.0 List of References 16 Executive Summary On April 14, 2004, NeuStar filed a petition with the Federal Communications Commission (FCC) seeking a ruling for modification of some of the current FCC policies that prohibit NeuStar from undertaking certain types of transactions without the prior approval of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256133A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256133A1.txt
  • WLR670 094-57-04.7 W 0001998716 GTE MOBILNET OF SOUTH TEXAS LIMILA MARQUE 01/10/2005 06093.45000 29-21-55.8 N CA MD KML37 117-19-12.1 W 0001998877 SOUTHERN CALIFORNIA EDISON COMCOLTON 01/10/2005 06404.79000 34-02-26.0 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WAJ88 117-14-04.2 W 0001998920 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/10/2005 06152.75000 34-13-56.0 N AL MD WLK853 087-47-05.6 W 0001999126 BellSouth Mobility LLC TUSCUMBIA 01/10/2005 06555.00000 34-42-09.4 N AL MD WMR773 087-43-13.0 W 0001999165 BellSouth Mobility LLC RUSSELLVILLE 01/10/2005 06725.00000 34-32-09.7 N AL MD WMR773 087-43-13.0 W 0001999165 BellSouth Mobility LLC RUSSELLVILLE 01/10/2005 06825.00000 34-32-09.7 N CA MD WPJA715 121-26-59.8 W 0001999465 NEW
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256267A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256267A1.txt
  • 42.8 10.2 8.4 Gabon $3,126,156 19.5 8.9 62.9 4.8 4.0 $44,936 39.6 0.0 57.2 0.0 3.2 $100,393 100.0 0.0 0.0 0.0 0.0 15,014,177 21.9 13.9 53.5 4.3 6.5 Gambia, The $3,702,971 23.8 13.8 24.2 14.2 24.0 $33,897 58.5 0.0 20.4 21.0 0.0 $40 100.0 0.0 0.0 0.0 0.0 22,584,044 33.1 14.3 19.4 8.3 24.9 Ghana $51,434,840 50.3 21.8 13.1 10.6 4.2 $386,431 42.5 0.0 41.0 16.4 0.1 $79,049 0.9 0.0 85.4 13.8 0.0 332,302,083 36.6 25.8 18.9 11.6 7.0 Guinea $7,109,161 36.4 27.2 23.8 5.6 7.0 $87,098 72.3 0.0 27.7 0.0 0.0 $277,243 97.8 0.0 2.2 0.0 0.0 59,796,752 46.2 22.2 17.1 5.0 9.4 Guinea-Bissau $2,975,564 68.0 3.9 9.4 7.9 10.8 $0 $0 4,412,299 55.5 5.3 21.9 9.6 7.6 - Switched
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256480A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256480A1.txt
  • 17925.00000 33-49-38.0 N CA MD WMR875 118-28-21.3 W 0002022042 Los Angeles SMSA Limited Partnership SYLMAR 01/25/2005 10552.50000 34-18-33.0 N CA MD WLT468 118-21-16.3 W 0002022058 LOS ANGELES SMSA LIMITED PARTNETORRANCE 01/25/2005 10573.12500 33-50-05.1 N CA MD WLT468 118-21-16.3 W 0002022058 LOS ANGELES SMSA LIMITED PARTNETORRANCE 01/25/2005 17915.00000 33-50-05.1 N OH MD WLT780 082-34-02.6 W 0002022082 New Par MANSFIELD 01/25/2005 02118.40000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002022082 New Par MANSFIELD 01/25/2005 02121.60000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002022082 New Par MANSFIELD 01/25/2005 06004.50000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002022082 New Par MANSFIELD 01/25/2005 06063.80000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002022082 New Par MANSFIELD 01/25/2005 11585.00000 40-43-04.2 N Page 12 CF - Common Carrier Fixed
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256564A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256564A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256564A1.txt
  • provided on their basic and expanded basic service tiers over the period studied. The competitive group, for example, increased the number of channels offered on their basic and expanded basic tiers by 4.0 percent over the 12-months ending January 1, 2004, to an average of 72.5 channels. Over the same time period, the noncompetitive group increased their channel offerings by 4.2 percent to an average of 70 channels. As a result, rates increased at a much slower pace or declined when measured on a per-channel basis. The average rate per channel charged by operators in the competitive group fell by 0.3 percent, from 60.1 cents to 59.9 cents per month, while the rate charged by operators in the noncompetitive group increased
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256639A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256639A1.txt
  • 0002034489 M/A-COM, INC. Perry 02/03/2005 06770.00000 29-50-25.0 N FL NE 081-09-23.0 W 0002034491 M/A-COM, INC. DAYTONA 02/03/2005 06605.00000 29-10-24.9 N FL NE 081-09-23.0 W 0002034491 M/A-COM, INC. DAYTONA 02/03/2005 06625.00000 29-10-24.9 N FL NE 082-58-04.0 W 0002034492 M/A-COM, INC. LIVE OAK 02/03/2005 06850.00000 30-13-43.7 N FL NE 081-27-52.0 W 0002034493 M/A-COM, INC. FERNANDINA BEAC 02/03/2005 06590.00000 30-39-34.0 N FL NE 081-07-04.2 W 0002034494 M/A-COM, INC. ORMOND BEACH 02/03/2005 06765.00000 29-15-31.9 N FL NE 081-07-04.2 W 0002034494 M/A-COM, INC. ORMOND BEACH 02/03/2005 06825.00000 29-15-31.9 N FL NE 081-15-49.2 W 0002034495 M/A-COM, INC. Bunnell 02/03/2005 06256.54000 29-32-06.9 N FL NE 081-18-34.2 W 0002034496 M/A -COM, INC. Bunnel 02/03/2005 05945.20000 29-20-39.9 N Page 30 CF - Common Carrier Fixed Point to Point Microwave State
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256825A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256825A1.txt
  • 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA MD WMN746 078-56-01.9 W 0002044176 ALLTEL COMMUNICATIONS OF VIRGINSOUTH BOSTON 02/11/2005 02112.00000 36-43-59.2 N VA MD WMN746 078-56-01.9 W 0002044176 ALLTEL COMMUNICATIONS OF VIRGINSOUTH BOSTON 02/11/2005 06093.45000 36-43-59.2 N CA MD WPOR717 118-00-04.2 W 0002044281 Los Angeles SMSA Limited Partnership WESTMINSTER 02/11/2005 17835.00000 33-44-46.0 N CA MD WMS226 118-01-12.2 W 0002044359 Los Angeles SMSA Limited Partnership WESTMINISTER 02/11/2005 17855.00000 33-45-34.0 N PR NE 066-02-11.0 W 0002036698 CENTENNIAL PUERTO RICO LICENSE CCAGUAS 02/07/2005 17930.00000 18-14-10.0 N HI NE 158-04-13.8 W 0002036717 Verizon Hawaii Inc Barber's Point 02/07/2005 10563.12500 21-18-01.6 N HI NE 158-05-20.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256927A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256927A1.txt
  • Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OK MD WPYT405 097-20-09.0 W 0002051636 USCOC OF OKLAHOMA RSA #10, INC.Orlanda 02/17/2005 06256.54000 36-07-01.0 N CA MD WPWJ624 115-45-52.4 W 0002051801 Cellco Partnership Seeley 02/17/2005 06423.12500 32-47-32.3 N PA MD WPON508 080-25-20.2 W 0002052137 Pittsburgh Cellular Telephone CompanyCLAYSVILLE 02/17/2005 06256.54000 40-07-04.2 N PA MD WPON508 080-25-20.2 W 0002052137 Pittsburgh Cellular Telephone CompanyCLAYSVILLE 02/17/2005 06375.14000 40-07-04.2 N PA MD WPQL583 080-26-12.2 W 0002052161 Pittsburgh Cellular Telephone CompanyFlorence 02/17/2005 06315.84000 40-25-50.2 N WV MD WPON509 080-35-24.2 W 0002052203 Pittsburgh Cellular Telephone CompanyWeirton 02/17/2005 06063.80000 40-27-47.2 N WV MD WPON507 080-38-21.2 W 0002052219 Pittsburgh Cellular Telephone CompanyWheeling 02/17/2005 06004.50000 40-02-22.2 N WV MD WPON507
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257247A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257247A1.pdf
  • broadband in South Dakota, followed by South Dakota PUC Chairman Sahr's presentation on broadband deployment in the state. DSL and cable modem service are deployed in dozens of towns throughout South Dakota, covering approximately 25,000 square miles and 66.5 percent of the state's population. Because of the state's low population density, the density of wireline deployments ranges from 1.6 to 4.2 subscribers per cable mile. Furthermore, the infrastructure costs for recent wireline deployments in the state ranged from $5,700 to $11,000 per customer. From the visit to South Dakota, the Task Force learned that there are unique challenges to serving sparsely-populated rural areas. Wireless technology is often a more cost-effective solution to serving such areas, yet challenges remain. Sioux Valley Wireless,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257439A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257439A1.txt
  • BROADBAND, LLC STEAMBOAT SPRIN 03/07/2005 21375.00000 40-27-09.4 N CO NE 106-49-12.1 W 0002071234 Aspen Skiing Company LLC Aspen 03/08/2005 21935.00000 39-09-05.8 N OR NE 123-04-39.5 W 0002071519 Salem, City of Salem 03/08/2005 00928.35625 45-52-15.9 N OR NE 123-04-39.5 W 0002071519 Salem, City of Salem 03/08/2005 00952.35625 45-52-15.9 N CO NE 106-52-14.1 W 0002071520 Aspen Skiing Company LLC Aspen 03/08/2005 23485.00000 39-09-04.2 N LA NE 092-37-18.0 W 0002071678 Network USA Glenmora 03/08/2005 06375.14000 30-54-21.0 N LA NE 092-26-24.0 W 0002071714 Network USA ALEXANDRIA 03/08/2005 06123.10000 31-16-05.0 N NV NE 115-11-30.7 W 0002071761 Nevada Power Company Sloan 03/08/2005 00928.43125 35-57-04.9 N NV NE 115-11-30.7 W 0002071761 Nevada Power Company Sloan 03/08/2005 00952.43125 35-57-04.9 N Page 35 MG - Microwave Industrial/Business Pool State Purpose
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257820A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257820A1.txt
  • PEN ARGYL 03/22/2005 06256.54000 40-53-00.3 N PA MD WPQL583 080-26-12.2 W 0002094858 Pittsburgh Cellular Telephone CompanyFlorence 03/22/2005 06315.84000 40-25-50.2 N WV MD WPON507 080-38-21.2 W 0002094872 Pittsburgh Cellular Telephone CompanyTRIADELPHIA 03/22/2005 06123.10000 40-02-22.2 N WV MD WPON509 080-35-24.2 W 0002094888 Pittsburgh Cellular Telephone CompanyWeirton 03/22/2005 06063.80000 40-27-47.2 N PA MD WPON508 080-25-20.2 W 0002094901 Pittsburgh Cellular Telephone CompanyCLAYSVILLE 03/22/2005 06375.14000 40-07-04.2 N WA MD WPJA860 122-08-42.0 W 0002094903 MCDANIEL CELLULAR TELEPHONE COMORTON 03/22/2005 02168.40000 46-29-46.0 N WA MD WPJA860 122-08-42.0 W 0002094903 MCDANIEL CELLULAR TELEPHONE COMORTON 03/22/2005 06635.62500 46-29-46.0 N WA MD WPJA860 122-08-42.0 W 0002094903 MCDANIEL CELLULAR TELEPHONE COMORTON 03/22/2005 06666.62500 46-29-46.0 N MT MD WMQ941 111-48-54.0 W 0002094956 WWC Holding Co., Inc. THREE FORKS 03/22/2005 06256.54000 45-51-08.0 N MT
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258113A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258113A1.txt
  • WPVX666 117-20-57.7 W 0002114892 County of , Spokane Spokane 04/05/2005 10795.00000 47-40-26.8 N WA MD WNTS765 117-27-49.4 W 0002114969 SPOKANE, COUNTY OF Deer Park 04/05/2005 00957.95000 47-57-13.5 N WA MD WNTS765 117-27-49.4 W 0002114969 SPOKANE, COUNTY OF Deer Park 04/05/2005 10875.00000 47-57-13.5 N WA MD WNEO794 117-20-06.7 W 0002114995 SPOKANE, COUNTY OF SPOKANE 04/05/2005 11365.00000 47-41-36.6 N CA MD WPJD520 117-32-04.2 W 0002116063 CALIFORNIA, STATE OF TRABUCO CANYON 04/06/2005 06765.00000 33-42-41.1 N CA MD KRO79 116-55-12.0 W 0002116064 CALIFORNIA, STATE OF POLOMAR MOUNT 04/06/2005 06545.00000 33-20-04.1 N UT MD WLA60 109-19-27.4 W 0002116746 UTAH, STATE OF MOAB 04/06/2005 11505.00000 38-31-43.9 N UT MD WNER784 109-32-12.1 W 0002117113 UTAH, STATE OF MOAB 04/07/2005 11015.00000 38-33-20.7 N FL MD WQBU612 082-27-19.0 W 0002118537
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258215A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258215A1.txt
  • 073-49-32.5 W 0001995063 New York SMSA Limited Partnership Flushing 04/13/2005 19400.00000 40-44-50.4 N NY AM 073-49-32.5 W 0001995063 New York SMSA Limited Partnership Flushing 04/13/2005 19480.00000 40-44-50.4 N NY AM 073-49-32.5 W 0001995063 New York SMSA Limited Partnership Flushing 04/13/2005 19560.00000 40-44-50.4 N CA AM KML37 117-19-12.1 W 0001998877 SOUTHERN CALIFORNIA EDISON COMCOLTON 04/11/2005 06404.79000 34-02-26.0 N CA AM WAJ88 117-14-04.2 W 0001998920 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 04/11/2005 06152.75000 34-13-56.0 N CA AM 116-57-50.6 W 0002015898 Verizon Wireless (VAW) LLC Lake Side 04/14/2005 10578.12500 32-57-24.9 N CA AM WLM959 117-07-45.1 W 0002016172 Verizon Wireless (VAW) LLC SAN DIEGO 04/11/2005 06256.54000 33-11-06.1 N CA AM WLM959 117-07-45.1 W 0002016172 Verizon Wireless (VAW) LLC SAN DIEGO 04/11/2005 11015.00000 33-11-06.1 N CA AM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258342A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258342A1.txt
  • A 0002116812 MOTIENT LICENSE INC. 04/06/2005 00810.83750 PA NE 075-25-06.0 W 0002116812 MOTIENT LICENSE INC. ALLENTOWN 04/06/2005 00855.83750 40-35-54.0 N GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL MD WPKR332 081-32-06.3 W 0002129068 FLORIDA HOSPITAL CELEBRATION 04/19/2005 00929.06250 28-19-45.0 N FL MD WPKR332 081-17-04.2 W 0002129068 FLORIDA HOSPITAL ORANGE CITY 04/19/2005 00929.06250 28-54-57.0 N FL MD WPKR332 081-19-40.0 W 0002129068 FLORIDA HOSPITAL WINTER PARK 04/19/2005 00929.06250 28-35-56.0 N FL MD WPKR333 081-22-29.2 W 0002129162 FLORIDA HOSPITAL ALTAMONTE SPRIN 04/19/2005 00929.06250 28-40-01.0 N FL MD WPKR333 081-30-09.3 W 0002129162 FLORIDA HOSPITAL APOPKA 04/19/2005 00929.06250 28-40-49.0 N FL MD WPKR333 081-42-45.6 W 0002129162 FLORIDA HOSPITAL EUSTIS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258528A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258528A1.txt
  • LLC EUCINTIAS 04/27/2005 33-03-03.2 N CA RM KNKA236 117-11-27.1 W 0002139150 Verizon Wireless (VAW) LLC FALLBROOK 04/27/2005 33-24-00.1 N CA RM KNKA236 116-56-03.1 W 0002139150 Verizon Wireless (VAW) LLC Jamul 04/27/2005 32-41-52.2 N CA RM KNKA236 116-35-07.1 W 0002139150 Verizon Wireless (VAW) LLC Julian 04/27/2005 33-00-26.2 N CA RM KNKA236 117-15-13.1 W 0002139150 Verizon Wireless (VAW) LLC LA JOLLA 04/27/2005 32-51-04.2 N CA RM KNKA236 117-15-13.1 W 0002139150 Verizon Wireless (VAW) LLC LA JOLLA 04/27/2005 32-51-04.2 N CA RM KNKA236 116-24-55.0 W 0002139150 Verizon Wireless (VAW) LLC MT LAGUNA 04/27/2005 32-52-38.0 N CA RM KNKA236 116-24-55.0 W 0002139150 Verizon Wireless (VAW) LLC MT LAGUNA 04/27/2005 32-52-38.0 N CA RM KNKA236 117-23-22.1 W 0002139150 Verizon Wireless (VAW) LLC OCEANSIDE 04/27/2005 33-12-27.1 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259061A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259061A1.txt
  • 41-53-20.1 N IL AM WLJ43 087-38-12.1 W 0002155564 Norlight Telecommunications, Inc. CHICAGO 05/26/2005 11175.00000 41-53-20.1 N IL AM WLJ43 087-38-12.1 W 0002155564 Norlight Telecommunications, Inc. CHICAGO 05/26/2005 22425.00000 41-53-20.1 N IL AM WLJ43 087-38-12.1 W 0002155564 Norlight Telecommunications, Inc. CHICAGO 05/26/2005 22775.00000 41-53-20.1 N IL AM WLJ43 087-38-12.1 W 0002155564 Norlight Telecommunications, Inc. CHICAGO 05/26/2005 23275.00000 41-53-20.1 N NC AM 080-54-04.2 W 0002173595 Conterra, LLC Statesville 05/25/2005 21875.00000 35-47-24.7 N NC AM 080-54-45.2 W 0002173696 Conterra, LLC Statesville 05/25/2005 11285.00000 35-47-17.5 N NC AM 080-54-45.2 W 0002173696 Conterra, LLC Statesville 05/25/2005 23075.00000 35-47-17.5 N NC AM 080-54-34.9 W 0002173821 Conterra, LLC Statesville 05/25/2005 10795.00000 35-43-03.3 N NC AM 080-54-34.9 W 0002173821 Conterra, LLC Statesville 05/25/2005 21975.00000 35-43-03.3 N NC AM 080-55-20.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259890A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259890A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259890A1.txt
  • carriers or used unbundled network element (UNE) loops that they leased from other carriers. ILECs reported providing about 3% fewer UNE loops with switching (referred to as the UNE-Platform) to unaffiliated carriers at the end of December 2004 than they reported six months earlier (16.5 million compared to 17.1 million) and also about 3% fewer UNE loops without switching (about 4.2 million). As additional information becomes available, it will be posted on the Commission's Internet site. . - FCC - Wireline Competition Bureau contacts: James Eisner and Ellen Burton at (202) 418-0940, TTY (202) 418-0484. NEWS Federal Communications Commission 445 12th Street, S.W. Washington, D. C. 20554 This is an unofficial announcement of Commission action. Release of the full text of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260261A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260261A1.txt
  • 0002250051 County of Spokane Spokane 07/22/2005 11285.00000 47-39-55.6 N WA MD KXW71 122-22-05.4 W 0002250352 TACOMA, CITY OF TACOMA 07/22/2005 06805.00000 47-10-58.3 N Page 39 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AL NE 088-03-54.3 W 0002242245 Mobile, County of Alabama SARALAND 07/15/2005 06750.00000 30-50-04.2 N AL NE 088-18-58.0 W 0002242247 Mobile, County of Alabama GRAND BAY 07/15/2005 06820.00000 30-36-15.0 N CO NE 104-59-28.0 W 0002243456 City of Thornton NORTHGLEN 07/18/2005 22235.00000 39-54-00.0 N CO NE 104-59-00.0 W 0002243462 City of Thornton Thornton 07/18/2005 23435.00000 39-52-13.9 N CA NE 117-01-02.2 W 0002243545 Sweetwater Union High School District San Diego 07/18/2005 23125.00000 32-33-55.3 N WA NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260366A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260366A1.txt
  • 19385.00000 33-19-12.4 N WA NE 122-11-19.5 W 0002257753 VOICESTREAM PCS III LICENCE CORPBOTHELL 07/28/2005 19475.00000 47-46-11.4 N Page 18 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 075-11-45.5 W 0002258060 Hotwire Communications LLC Philadelphia 07/29/2005 19480.00000 39-57-25.4 N PA NE 075-12-04.2 W 0002258064 Hotwire Communications LLC Philadelphia 07/29/2005 17920.00000 40-00-29.7 N OK NE 098-38-38.0 W 0002258244 TEXAHOMA CELLULAR LIMITED PARTNCHATTANOOGA 07/29/2005 06715.62500 34-25-42.0 N CA NE 122-01-57.0 W 0002258523 MetroFi Inc. Cupertino 07/29/2005 19400.00000 37-19-28.0 N CA NE 121-59-44.1 W 0002258625 MetroFi Inc Santa Clara 07/29/2005 19360.00000 37-20-52.2 N OK NE 096-34-47.0 W 0002258669 UNITED STATES CELLULAR TELEPHONOILTON 07/29/2005 06765.00000 36-07-05.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260437A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260437A1.txt
  • 43.2 386 2.5 126 0.8 247 1.6 252 1.6 7,826 50.3 15,553 Delaware 2,199 53.0 39 1.0 88 2.1 99 2.4 19 0.5 1,705 41.1 4,150 District of Columbia 3,560 66.6 22 0.4 154 2.9 158 3.0 22 0.4 1,427 26.7 5,343 Florida 33,561 49.4 1,706 2.5 504 0.7 2,315 3.4 1,025 1.5 28,819 42.4 67,930 Georgia 16,689 44.3 1,597 4.2 304 0.8 1,435 3.8 434 1.2 17,238 45.7 37,697 Guam Not shown to protect carrier confidentiality Hawaii 2,616 57.3 25 0.5 14 0.3 99 2.2 73 1.6 1,741 38.1 4,568 Idaho 2,391 40.6 26 0.4 70 1.2 108 1.8 67 1.1 3,230 54.8 5,892 Illinois 23,822 40.8 1,122 1.9 875 1.5 1,033 1.8 573 1.0 30,912 53.0 58,337 Indiana 9,570
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260472A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260472A1.txt
  • 119-05-30.0 W 0002265106 MCI Network Services, Inc. CONNER 08/04/2005 06286.19000 35-12-06.0 N CA MD WGX513 119-05-30.0 W 0002265106 MCI Network Services, Inc. CONNER 08/04/2005 06315.84000 35-12-06.0 N CA MD WGX513 119-05-30.0 W 0002265106 MCI Network Services, Inc. CONNER 08/04/2005 06345.49000 35-12-06.0 N CA MD WGX513 119-05-30.0 W 0002265106 MCI Network Services, Inc. CONNER 08/04/2005 06404.79000 35-12-06.0 N NH MD WPJF602 071-16-04.2 W 0002265316 New Cingular Wireless PCS, LLC CHESTER 08/04/2005 10621.25000 42-57-05.3 N NH MD WPJF602 071-16-04.2 W 0002265316 New Cingular Wireless PCS, LLC CHESTER 08/04/2005 11132.50000 42-57-05.3 N NH MD WMN299 071-16-02.2 W 0002265333 New Cingular Wireless PCS, LLC CANDIA 08/04/2005 02124.80000 43-03-12.3 N NH MD WMN299 071-16-02.2 W 0002265333 New Cingular Wireless PCS, LLC CANDIA 08/04/2005 10556.25000 43-03-12.3 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260515A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260515A1.pdf
  • Order 400. Chairman Atkinson inquired as to whether any of the NANC members had changed their pro or con position. There were no changes in position. Anna Miller, T-Mobile, USA, suggested that the NANC forward the NANC Report and Recommendation as it has been presented to the FCC. John Jefferson, SBC, agreed. Adam Newman, Telcordia, submitted a revision to Section 4.2 of the Report and Recommendation, along with a minor revision of the Con Section headings. No NANC members were opposed to Mr. Newman's additions to the Report Recommendation. There was a NANC consensus to forward the Report and Recommendation on NANC Change Orders 399 and 400 to the FCC. Chairman Atkinson agreed to prepare a cover letter indicating that the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260891A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260891A2.pdf
  • letter from the requesting carrier identifying a block/code in service in another rate center that already uses the same facilities that will be used to serve the new rate center where the initial block/code is being requested. All documentation submitted will be held confidential pursuant to FCC confidentiality rules. Central Office Code (NXX) Assignment Guidelines (COCAG) (June 10, 2005) Section 4.2.2 Facilities Readiness Appropriate evidence that facilities are in place or will be in place to provide service within 60 days of the numbering resources activation date (LERG Routing Guide effective date). Evidence may be provided via a copy of any one of the following document(s) the SP selects: An executed interconnection agreement between a Local Exchange Carrier and the service
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260929A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260929A1.txt
  • 08/19/2005 17:27:22:66300 Date Filed: SES Americom, Inc. SES Americom, Inc. (SES Americom) has filed an application for modification of its license for its in-orbit fixed-satellite service hybrid C-/Ku-band satellite, AMC-6, authorized at the 72º W.L. orbital position to operate in the extended Ku-band. AMC-6 is currently authorized to operate in the C-band, 5.925 - 6.425 GHz (Earth-to-space) and 3.7 - 4.2 GHz (space-to-Earth) and in the Ku-band, 14.0 -14.5 GHz (Earth-to-space) and 11.7 - 12.2 GHz (space-to-Earth). In response to customer demand, SES Americom plans to provide service to South America in the standard and extended Ku-bands and will modify its coverage areas accordingly. Specifically, SES Americom seeks to add the extended Ku-band, 13.75 - 14.0 GHz and 11.45 - 11.7
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260984A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260984A1.txt
  • 0002301789 NEXTEL LICENSE HOLDINGS 1, INC. Orange 09/06/2005 10626.25000 28-55-27.3 N FL NE 081-21-53.6 W 0002301790 NEXTEL LICENSE HOLDINGS 1, INC. MAITLAND 09/06/2005 18085.00000 28-44-02.4 N FL NE 080-08-16.6 W 0002302008 NEXTEL LICENSE HOLDINGS 1, INC. FT. LAUDERDALE 09/06/2005 06795.00000 26-07-21.3 N FL NE 080-08-16.6 W 0002302008 NEXTEL LICENSE HOLDINGS 1, INC. FT. LAUDERDALE 09/06/2005 11325.00000 26-07-21.3 N FL NE 080-19-04.2 W 0002302009 NEXTEL LICENSE HOLDINGS 1, INC. SUNRISE 09/06/2005 10643.12500 26-09-13.8 N FL NE 080-15-59.9 W 0002302010 NEXTEL LICENSE HOLDINGS 1, INC. PLANTATION 09/06/2005 10556.25000 26-06-15.3 N FL NE 080-13-02.7 W 0002302011 NEXTEL LICENSE HOLDINGS 1, INC. MIAMI 09/06/2005 06745.00000 25-55-27.2 N FL NE 080-13-02.7 W 0002302011 NEXTEL LICENSE HOLDINGS 1, INC. MIAMI 09/06/2005 06765.00000 25-55-27.2 N Page 17 CF
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261024A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261024A2.txt
  • 4.0 1964 62.9 13.6 14.6 17.2 58.0 138.1 166.3 4,615 3.6 1965 78.2 15.9 20.2 21.3 50.6 150.1 186.2 5,092 3.7 1966 100.1 17.6 29.0 27.3 49.7 177.2 223.7 5,843 3.8 1967 114.2 15.1 31.3 33.7 49.8 197.7 244.0 6,375 3.8 1968 126.9 15.4 36.6 44.3 50.5 221.8 273.8 7,126 3.8 1969 172.0 16.8 45.4 56.0 53.8 281.8 344.0 8,232 4.2 1970 196.6 15.5 49.9 63.1 53.1 312.8 378.2 8,956 4.2 1971 237.4 12.7 52.0 72.5 49.2 359.1 423.8 9,962 4.3 1972 291.8 14.2 57.7 88.3 44.8 424.9 496.9 11,323 4.4 1973 364.9 15.1 62.8 115.0 47.7 527.6 605.5 13,126 4.6 1974 428.7 12.9 64.1 142.7 52.3 623.7 700.8 14,582 4.8 1975 490.2 13.2 69.2 163.4 42.5 696.1 778.5 16,098 4.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261169A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261169A1.txt
  • RSA 19 LIMITED PARTNERSHIPSAN ISIDRO 09/15/2005 06197.24000 26-42-38.7 N TX MD WPNA977 098-27-48.0 W 0002316636 TEXAS RSA 19 LIMITED PARTNERSHIPSAN ISIDRO 09/15/2005 06605.00000 26-42-38.7 N TX MD WMT576 098-37-40.5 W 0002316645 TEXAS RSA 19 LIMITED PARTNERSHIPAGUA NUEVA 09/15/2005 05945.20000 26-48-56.6 N TX MD WMT576 098-37-40.5 W 0002316645 TEXAS RSA 19 LIMITED PARTNERSHIPAGUA NUEVA 09/15/2005 06731.25000 26-48-56.6 N NC MD WQDF501 080-54-04.2 W 0002316761 Conterra, LLC Statesville 09/15/2005 21975.00000 35-47-24.7 N TX MD WMM957 098-08-50.7 W 0002316784 TEXAS RSA 19 LIMITED PARTNERSHIPALICE 09/15/2005 06315.84000 27-44-26.9 N CA MD WHB412 118-35-32.3 W 0002317783 Los Angeles SMSA Limited Partnership Valencia 09/16/2005 11642.50000 34-25-36.9 N CA MD WPOP881 118-38-28.3 W 0002317832 Los Angeles SMSA Limited Partnership LOS ANGELES 09/16/2005 10646.25000 34-11-16.0 N CA MD WPON322
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261981A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261981A1.txt
  • W 0002355931 RCC Minnesota, Inc. Biddeford 10/24/2005 06197.24000 43-28-57.0 N ME NE 070-31-25.7 W 0002355931 RCC Minnesota, Inc. Biddeford 10/24/2005 06345.49000 43-28-57.0 N ME NE 070-31-25.7 W 0002355931 RCC Minnesota, Inc. Biddeford 10/24/2005 06625.00000 43-28-57.0 N VA NE 077-30-54.4 W 0002355934 Telecom Transport Management, Inc Richmond 10/24/2005 23030.00000 37-36-15.1 N OH NE 081-29-10.4 W 0002356218 FIBERTOWER CORPORATION Twinsburg 10/24/2005 23070.00000 41-20-04.2 N OH NE 081-15-57.4 W 0002356221 FIBERTOWER CORPORATION Louisville 10/24/2005 19320.00000 40-49-56.8 N OH NE 081-18-23.0 W 0002356222 FIBERTOWER CORPORATION FAIRHOPE 10/24/2005 17760.00000 40-49-43.0 N OH NE 081-18-23.0 W 0002356222 FIBERTOWER CORPORATION FAIRHOPE 10/24/2005 17980.00000 40-49-43.0 N CO NE 105-08-30.2 W 0002356655 LP Broadband, Inc. Loveland 10/24/2005 19440.00000 40-25-03.6 N OR NE 118-57-31.3 W 0002356660 RCC Minnesota, Inc. John Day
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262086A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262086A1.txt
  • . . . . . . . . . . . . . . . . . . .111 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . . . . . . 115 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2004. . . . . . . . . . . . . . . . . . . . . . 116 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . .
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262210A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262210A1.txt
  • ARIZONA TUCSON 11/08/2005 11035.00000 32-13-43.2 N AZ NE 111-00-17.8 W 0002375392 TUCSON CITY ARIZONA TUCSON 11/08/2005 10955.00000 32-12-51.4 N AZ NE 110-52-41.2 W 0002375396 TUCSON CITY ARIZONA TUCSON 11/08/2005 11365.00000 32-15-09.0 N AZ NE 110-56-45.5 W 0002375397 TUCSON CITY ARIZONA TUCSON 11/08/2005 11285.00000 32-14-25.8 N AZ NE 110-56-48.4 W 0002375400 TUCSON CITY ARIZONA TUCSON 11/08/2005 11485.00000 32-10-15.9 N WI NE 090-11-04.2 W 0002375402 Marshfield School District Marshfield 11/08/2005 19480.00000 44-39-55.7 N WI NE 090-11-04.2 W 0002375402 Marshfield School District Marshfield 11/08/2005 21925.00000 44-39-55.7 N AZ NE 110-57-50.3 W 0002375405 TUCSON CITY ARIZONA TUCSON 11/08/2005 11285.00000 32-10-51.7 N AZ NE 110-51-16.5 W 0002375410 TUCSON CITY ARIZONA TUCSON 11/08/2005 11485.00000 32-13-36.7 N AZ NE 110-51-19.8 W 0002375412 TUCSON CITY ARIZONA TUCSON 11/08/2005 11245.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262330A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262330A1.txt
  • correction continues beyond the date of publication of this report, as new problems are identified. Reporting companies frequently re-file data, not only for the current reporting period, but also occasionally for previous reporting periods. Hence, users of the quality of service report data may find some inconsistencies with data extracted from the ARMIS database at a later or earlier date. 4.2 Commission Recalculation of Holding Company Aggregate Statistics Commission staff do not typically delete or adjust company-filed data for presentation in the quality of service report, except for recalculating holding company totals and other data aggregates as described in Section 3.1. Recalculated aggregates appear in the tables of the quality of service report. These may not match corresponding company-filed totals and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262354A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262354A1.txt
  • PAXTON 11/16/2005 06855.00000 42-18-15.7 N MA MD WLU791 071-53-50.0 W 0002382036 CELLCO PARTNERSHIP PAXTON 11/16/2005 10658.12500 42-18-15.7 N MA MD WLU791 071-53-50.0 W 0002382036 CELLCO PARTNERSHIP PAXTON 11/16/2005 10668.12500 42-18-15.7 N MA MD WLU791 071-53-50.0 W 0002382036 CELLCO PARTNERSHIP PAXTON 11/16/2005 10755.00000 42-18-15.7 N MA MD WLU791 071-53-50.0 W 0002382036 CELLCO PARTNERSHIP PAXTON 11/16/2005 10835.00000 42-18-15.7 N MA MD WPOU575 071-35-04.2 W 0002382047 CELLCO PARTNERSHIP WESTBOROUGH 11/16/2005 06256.54000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0002382047 CELLCO PARTNERSHIP WESTBOROUGH 11/16/2005 06286.19000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0002382047 CELLCO PARTNERSHIP WESTBOROUGH 11/16/2005 06315.84000 42-16-59.3 N MA MD WPOU575 071-35-04.2 W 0002382047 CELLCO PARTNERSHIP WESTBOROUGH 11/16/2005 06345.49000 42-16-59.3 N Page 6 CF - Common Carrier Fixed Point to Point Microwave State
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262703A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262703A1.txt
  • Sweet Grass 12/06/2005 06645.00000 45-47-34.4 N MT NE 112-00-30.7 W 0002401131 State of Montana Cascade 12/06/2005 05945.20000 47-17-21.4 N MT NE 112-00-30.7 W 0002401131 State of Montana Cascade 12/06/2005 06286.19000 47-17-21.4 N CA NE 117-04-21.0 W 0002401589 METROPOLITAN WATER DIST OF SO CALIFORNIA WINCHESTER 12/06/2005 19395.00000 33-34-42.0 N MT NE 112-06-12.4 W 0002404170 State of Montana Wolf Creek 12/08/2005 06034.15000 47-00-04.2 N MT NE 112-06-12.4 W 0002404170 State of Montana Wolf Creek 12/08/2005 06063.80000 47-00-04.2 N ID NE 116-16-20.1 W 0002405101 ADA, COUNTY OF BOISE 12/09/2005 06765.00000 43-36-26.1 N ID NE 116-16-20.1 W 0002405101 ADA, COUNTY OF BOISE 12/09/2005 06785.00000 43-36-26.1 N ID NE 116-16-20.1 W 0002405101 ADA, COUNTY OF BOISE 12/09/2005 06805.00000 43-36-26.1 N ID NE 116-16-20.1 W 0002405101 ADA,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A1.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements per Student ..........................................
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A2.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements per Student ..........................................
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A3.txt
  • revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For the years 1993 - 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass- through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A6.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A6.txt
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for Funding Years 2002, 2003 and 2004. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A9.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A9.txt
  • 2000 2001 2002 2003 2004 Percen t Ch ang e fro m P rior Y ear CPI - All Items CPI - Telephone Service 7 - 7 1978 1.4% 3.1% -0.7% 0.0% 1.3% 0.1% 1979 1.7 1.6 -0.8 -0.9 0.1 -0.7 1980 7.0 7.1 3.4 5.5 -0.6 2.3 1981 12.6 15.6 14.6 15.9 6.2 8.0 1982 10.8 9.0 2.7 3.9 4.2 1.7 1983 3.1 0.2 1.4 0.0 7.4 3.9 1984 17.2 10.4 -4.3 -5.1 3.6 3.8 1985 8.9 12.4 -3.7 -3.0 0.6 2.1 1986 7.1 8.9 -9.4 -10.0 0.3 -3.5 1987 3.3 2.6 -12.4 -11.8 -3.0 -3.0 1988 4.5 4.6 -4.2 -2.1 -4.2 -3.8 1989 0.6 1.9 -1.3 -1.7 -2.6 0.5 1990 1.0 1.5 -3.7 -0.1 -2.2 -2.2 1991 5.1 2.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263047A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263047A1.txt
  • N AZ MD WPYQ252 114-38-20.9 W 0002423878 City of Yuma Yuma 12/28/2005 17840.00000 32-39-54.4 N AZ MD WPYQ251 114-28-42.5 W 0002423901 City of Yuma Yuma 12/28/2005 19600.00000 32-40-46.4 N AZ MD WPZV899 114-37-14.4 W 0002423915 City of Yuma Yuma 12/28/2005 17760.00000 32-43-16.5 N AZ MD WPYQ250 114-37-10.8 W 0002423948 City Of Yuma Yuma 12/28/2005 17960.00000 32-42-48.2 N CA MD WPJD520 117-32-04.2 W 0002423953 CALIFORNIA, STATE OF TRABUCO CANYON 12/28/2005 06745.00000 33-42-41.1 N CA MD KNA64 117-17-21.1 W 0002423954 CALIFORNIA, STATE OF RIVERSIDE 12/28/2005 06545.00000 33-57-58.1 N Page 20 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KNA64 117-17-21.1 W 0002423954 CALIFORNIA, STATE OF RIVERSIDE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263377A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263377A1.txt
  • 111-38-04.0 W 0002449241 CNG COMMUNICATIONS, INC. FLAGSTAFF 01/18/2006 18000.00000 35-11-25.0 N AZ MD WPVU895 111-38-04.0 W 0002449241 CNG COMMUNICATIONS, INC. FLAGSTAFF 01/18/2006 18040.00000 35-11-25.0 N OR MD WPNJ819 118-15-40.0 W 0002449800 OREGON RSA NO. 2 LIMITED PARTNERMILTON-FREEWAT 01/18/2006 06560.62500 45-49-51.0 N OR MD WPNJ819 118-15-40.0 W 0002449800 OREGON RSA NO. 2 LIMITED PARTNERMILTON-FREEWAT 01/18/2006 06645.00000 45-49-51.0 N NC MD WQDF501 080-54-04.2 W 0002450270 Conterra Ultra Broadband, LLC Statesville 01/18/2006 21825.00000 35-47-24.7 N Page 9 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC MD WQDF501 080-54-04.2 W 0002450270 Conterra Ultra Broadband, LLC Statesville 01/18/2006 21925.00000 35-47-24.7 N NC MD WQDF501 080-54-04.2 W 0002450270
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263555A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263555A1.txt
  • 01/23/2006 19435.00000 48-06-48.8 N WA NE 122-55-37.6 W 0002455864 T-MOBILE LICENSE LLC f/k/a VOICESTRPORT TOWNSEND 01/23/2006 17875.00000 48-00-57.4 N WA NE 122-55-37.6 W 0002455864 T-MOBILE LICENSE LLC f/k/a VOICESTRPORT TOWNSEND 01/23/2006 17905.00000 48-00-57.4 N WA NE 122-45-40.3 W 0002455865 T-MOBILE LICENSE LLC f/k/a VOICESTRCHIMACUM 01/23/2006 19465.00000 47-59-11.3 N WA NE 122-07-24.0 W 0002455866 T-MOBILE LECENSE LLC f/k/a VOICESTSNOHOMISH 01/23/2006 19385.00000 47-56-04.2 N WA NE 121-55-25.1 W 0002455867 T-MOBILE LICENSE LLC f/k/a VOICESTRMONROE 01/23/2006 17825.00000 47-48-56.0 N WA NE 122-11-44.2 W 0002455868 T-MOBILE LICENSE LLC f/k/a VOICESTRMARYSVILLE 01/23/2006 23175.00000 48-05-50.0 N WA NE 122-10-29.5 W 0002455869 T-MOBILE LICENSE LLC f/k/a VOICESTRMARYSVILLE 01/23/2006 21975.00000 48-06-02.9 N ID NE 116-52-03.0 W 0002456074 Noel Communications, Inc Plummer 01/23/2006 06375.14000 47-18-46.0 N CO NE 105-08-15.6 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263695A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263695A1.txt
  • INC MILFORD 01/30/2006 00857.03750 38-24-02.9 N MD WPIT212 A 0002465685 PCS COMMUNICATIONS INC 01/30/2006 00809.00000 - 00824.00000 UT MD WPIT212 113-34-22.8 W 0002465685 PCS COMMUNICATIONS INC SAINT GEORGE 01/30/2006 00856.51250 37-03-48.9 N TX MD WNJJ818 101-55-57.5 W 0002467901 JOSH KLASSEN INC IRAAN 01/31/2006 00851.23750 30-49-36.6 N MD WPEH585 A 0002467946 Wireless US LLC 01/31/2006 00809.00000 - 00824.00000 IL MD WPEH585 088-19-04.2 W 0002467946 Wireless US LLC Champaign 01/31/2006 00860.13750 40-10-51.1 N MD WPER954 A 0002467953 Wireless US LLC 01/31/2006 00809.00000 - 00824.00000 MS MD WPER954 090-11-53.3 W 0002467953 Wireless US LLC JACKSON 01/31/2006 00854.01250 32-16-25.5 N MD WPEJ964 A 0002470206 SMITH, ELEANOR 02/01/2006 00806.00000 - 00821.00000 TN MD WPEJ964 086-46-45.0 W 0002470206 SMITH, ELEANOR NASHVILLE 02/01/2006 00852.83750 36-09-49.2 N MD WPHY839
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264306A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264306A1.txt
  • (MHz) Applicant Name Latitude City OH AM WQCZ891 081-59-27.3 W 0002439719 FIBERTOWER CORPORATION AVON 03/06/2006 19440.00000 41-27-55.5 N OH AM WQCZ891 081-59-27.3 W 0002439719 FIBERTOWER CORPORATION AVON 03/06/2006 19600.00000 41-27-55.5 N OH AM WQCZ891 081-59-27.3 W 0002439719 FIBERTOWER CORPORATION AVON 03/06/2006 19620.00000 41-27-55.5 N OH AM 081-54-54.8 W 0002439734 FIBERTOWER CORPORATION Columbia Station 03/06/2006 17760.00000 41-21-00.8 N NC AM WQDF501 080-54-04.2 W 0002450270 Conterra Ultra Broadband, LLC Statesville 03/06/2006 21825.00000 35-47-24.7 N NC AM WQDF501 080-54-04.2 W 0002450270 Conterra Ultra Broadband, LLC Statesville 03/06/2006 21925.00000 35-47-24.7 N NC AM WQDF501 080-54-04.2 W 0002450270 Conterra Ultra Broadband, LLC Statesville 03/06/2006 21975.00000 35-47-24.7 N NC AM 080-52-40.8 W 0002450331 Conterra Ultra Broadband, LLC Statesville 03/06/2006 23025.00000 35-46-45.7 N NC AM 080-52-40.8 W 0002450331
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264309A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264309A1.txt
  • 0.0 55.1 $9 0.0 0.0 11.1 0.0 88.9 15,064,396 19.0 6.4 37.9 17.4 19.3 Netherlands $58,919,086 47.2 1.3 18.7 26.2 6.6 $12,649,734 22.4 2.0 57.5 6.9 11.2 $12,053,117 0.0 99.6 0.2 0.0 0.1 881,854,596 18.6 1.3 41.7 13.4 24.9 Norway $17,632,585 33.5 4.4 23.8 30.0 8.3 $2,013,750 25.2 3.6 9.6 52.9 8.6 $2,700,306 0.0 99.9 0.0 0.0 0.1 207,737,852 28.1 4.2 27.5 29.4 10.9 Portugal $18,076,446 52.0 8.3 24.5 2.9 12.4 $1,320,712 20.5 0.3 31.2 6.2 41.7 $211,754 0.0 93.8 0.1 0.0 6.1 186,855,189 23.6 8.7 34.0 4.8 28.9 Spain $79,156,060 41.0 5.8 13.0 32.5 7.7 $4,661,204 28.6 18.5 24.3 6.4 22.2 $29,250,559 0.0 99.6 0.0 0.0 0.4 622,801,007 27.6 10.6 19.1 20.0 22.6 Sweden $31,216,683 44.4 1.8 31.7 14.6 7.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264456A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264456A1.txt
  • Inc.Sidney 03/13/2006 06197.24000 41-08-40.7 N WA NE 118-45-13.9 W 0002523718 T-MOBILE LICENSE LLC f/k/a VOICESTRTouchet 03/13/2006 17895.00000 46-03-57.4 N WA NE 118-36-59.5 W 0002523719 T-MOBILE LICENSE LLC f/k/a VOICESTRTouchet 03/13/2006 19395.00000 46-02-06.9 N WA NE 118-36-59.5 W 0002523719 T-MOBILE LICENSE LLC f/k/a VOICESTRTouchet 03/13/2006 19455.00000 46-02-06.9 N WA NE 118-21-22.3 W 0002523720 T-MOBILE LICENSE LLC f/k/a VOICESTRWalla Walla 03/13/2006 17835.00000 46-04-04.2 N NM NE 108-59-19.4 W 0002524857 New Mexico RSA No. 5 Limited PartnershSetins 03/14/2006 06605.00000 32-12-51.6 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ NE 109-13-31.8 W 0002524858 Verizon Wireless (VAW) LLC San Simone 03/14/2006 06765.00000 32-16-01.5 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264548A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264548A1.txt
  • N MD NE 077-43-46.2 W 0002541675 Aviation Spectrum Resources, Inc Hagerstown 03/23/2006 00129.70000 39-42-28.6 N TX NE 098-28-11.2 W 0002541676 Aviation Spectrum Resources, Inc San Antonio 03/23/2006 00131.95000 29-32-01.3 N SC NE 080-02-25.9 W 0002541680 Aviation Spectrum Resources, Inc Charleston 03/23/2006 00130.95000 32-53-55.1 N TX NE 096-51-06.4 W 0002541681 Aviation Spectrum Resources, Inc Dallas 03/23/2006 00131.95000 32-50-49.6 N FL NE 082-32-04.2 W 0002541685 Aviation Spectrum Resources, Inc Tampa 03/23/2006 00136.85000 27-57-36.4 N CA NE 122-13-14.6 W 0002541691 Aviation Spectrum Resources, Inc Oakland 03/23/2006 00131.97500 37-43-16.6 N MS NE 088-35-29.9 W 0002541694 Aviation Spectrum Resources, Inc Columbus 03/23/2006 00130.85000 33-27-01.2 N NC NE 077-36-43.7 W 0002541697 Aviation Spectrum Resources, Inc Jacksonville 03/23/2006 00131.55000 34-49-44.9 N NC NE 077-36-43.7 W 0002541700 Aviation Spectrum
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264743A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264743A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264743A1.txt
  • from other carriers, and about 17% through resale arrangements with unaffiliated carriers. ILECs reported providing about 12% fewer UNE loops with switching (referred to as the UNE-Platform) to unaffiliated carriers at the end of June 2005 than they reported six months earlier (14.6 million compared to 16.5 million) and about 2% more UNE loops without switching (4.3 million compared to 4.2 million). ILECs were the presubscribed interstate long distance carrier for about 49% of the switched access lines they provided to end users. For CLECs, the percentage was 74%. As additional information becomes available, it will be posted on the Commission's Internet site. . - FCC - Wireline Competition Bureau contacts: James Eisner and Ellen Burton at (202) 418-0940, TTY (202)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264785A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264785A1.txt
  • 03/28/2006 00809.00000 - 00824.00000 TX MD WPHA905 X 0002552099 Estate of Eugene M. Allen 03/28/2006 00809.00000 - 00824.00000 MD MD WPHA905 075-34-05.7 W 0002552099 Estate of Eugene M. Allen SALISBURY 03/28/2006 00860.13750 38-24-35.4 N MD WPHJ207 A 0002552110 ALLEN, DAVID M 03/28/2006 00809.00000 - 00824.00000 CA MD WPHJ207 X 0002552110 ALLEN, DAVID M 03/28/2006 00809.00000 - 00824.00000 IL MD WPHJ207 088-19-04.2 W 0002552110 ALLEN, DAVID M CHAMPAIGN 03/28/2006 00860.08750 40-10-51.1 N MD WPGR344 A 0002552125 ALLEN, DAVID M 03/28/2006 00809.00000 - 00824.00000 CA MD WPGR344 X 0002552125 ALLEN, DAVID M 03/28/2006 00809.00000 - 00824.00000 MD MD WPGR344 075-34-05.7 W 0002552125 ALLEN, DAVID M SALISBURY 03/28/2006 00860.53750 38-24-35.4 N MD WPGN432 A 0002552130 ALLEN, DAVID M 03/28/2006 00809.00000 - 00824.00000 CA MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264878A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264878A1.txt
  • MESA 04/07/2006 11245.00000 32-46-07.4 N CA MD WLU305 117-01-45.1 W 0002562930 Verizon Wireless (VAW) LLC LA MESA 04/07/2006 11405.00000 32-46-07.4 N TX MD WPYH804 097-04-18.0 W 0002563763 FIBERTOWER CORPORATION FLOWER MOUND 04/07/2006 19360.00000 33-01-54.0 N TX MD WPYH804 097-04-18.0 W 0002563763 FIBERTOWER CORPORATION FLOWER MOUND 04/07/2006 19480.00000 33-01-54.0 N TX MD WQEK363 096-36-07.8 W 0002563766 FIBERTOWER CORPORATION GARLAND 04/07/2006 19680.00000 32-58-04.2 N TX MD WQEE756 097-03-49.0 W 0002563768 FIBERTOWER CORPORATION Flower Mound 04/07/2006 19320.00000 33-02-15.0 N TX MD WQEE754 097-04-55.0 W 0002563770 FIBERTOWER CORPORATION Flower Mound 04/07/2006 17760.00000 33-01-55.0 N TX MD WQEE754 097-04-55.0 W 0002563770 FIBERTOWER CORPORATION Flower Mound 04/07/2006 17800.00000 33-01-55.0 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264989A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264989A1.txt
  • 1 03/15/2006 WQCI885 MO ELTTAC INC 452.45000000 -- -- 2 1 03/15/2006 WQCI885 MO ELTTAC INC 457.45000000 -- -- 2 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. PW - Public Safety Pool, Conventional Public Safety & Critical Infrastructure Division 03/16/2006 KGL580 FB PENFIELD VOLUNTEER EMERGENCY AMBULAN 155.39250000 PENFIELD 43-10-4.2 N NY 77-26-51.0 W 1 2 03/16/2006 KGL580 FB PENFIELD VOLUNTEER EMERGENCY AMBULAN 156.23250000 PENFIELD 43-10-4.2 N NY 77-26-51.0 W 1 2 03/16/2006 KGL580 MO PENFIELD VOLUNTEER EMERGENCY AMBULAN 155.39250000 -- -- 2 1 Page 6 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. PW - Public
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265170A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265170A1.txt
  • 96 0.6 526 3.2 278 1.7 7,619 47.0 16,216 South Dakota 1,152 21.4 23 0.4 29 0.5 52 1.0 28 0.5 4,093 76.1 5,376 Tennessee 10,600 42.3 520 2.1 162 0.6 612 2.4 305 1.2 12,861 51.3 25,059 Texas 41,093 42.5 2,577 2.7 864 0.9 2,732 2.8 2,062 2.1 47,446 49.0 96,774 Utah 4,806 44.9 37 0.3 93 0.9 451 4.2 86 0.8 5,219 48.8 10,692 Vermont 2,060 45.1 5 0.1 53 1.2 48 1.0 49 1.1 2,352 51.5 4,566 Virgin Islands 143 46.2 10 3.3 30 9.6 31 10.0 2 0.6 94 30.3 309 Virginia 15,630 54.5 54 0.2 494 1.7 722 2.5 178 0.6 11,612 40.5 28,691 Washington 12,547 45.7 1,133 4.1 317 1.2 670 2.4 367 1.3 12,420
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265186A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265186A1.txt
  • N CA MD WPOT934 117-34-01.1 W 0002586187 SOUTHERN CALIFORNIA EDISON COMONTARIO 04/28/2006 06315.84000 34-00-31.0 N CA MD WPOT934 117-34-01.1 W 0002586187 SOUTHERN CALIFORNIA EDISON COMONTARIO 04/28/2006 06404.79000 34-00-31.0 N CA MD WPOT934 117-34-01.1 W 0002586187 SOUTHERN CALIFORNIA EDISON COMONTARIO 04/28/2006 06695.00000 34-00-31.0 N CA MD WPOT934 117-34-01.1 W 0002586187 SOUTHERN CALIFORNIA EDISON COMONTARIO 04/28/2006 10705.00000 34-00-31.0 N CA MD WAJ88 117-14-04.2 W 0002586188 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 04/28/2006 06063.80000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0002586188 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 04/28/2006 06152.75000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0002586188 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 04/28/2006 06197.24000 34-13-56.0 N PR MD WPSN615 066-01-56.1 W 0002586190 SprintCom, Inc. (Puerto Rico) CARRAIZO 04/28/2006 11621.25000 18-19-23.3 N PR MD WPSN615 066-01-56.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265287A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265287A1.txt
  • AM 082-19-37.3 W 0002582130 FIBERTOWER CORPORATION Tampa 05/03/2006 10795.00000 27-57-57.6 N FL AM 082-19-37.3 W 0002582130 FIBERTOWER CORPORATION Tampa 05/03/2006 10875.00000 27-57-57.6 N OH MD WLU764 081-27-59.0 W 0002586556 New Par STOW 04/28/2006 06550.00000 41-11-20.0 N OH MD WLU764 081-27-59.0 W 0002586556 New Par STOW 04/28/2006 10563.12500 41-11-20.0 N OH MD WLT780 082-34-02.6 W 0002586557 New Par MANSFIELD 04/28/2006 02121.60000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002586557 New Par MANSFIELD 04/28/2006 06004.50000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002586557 New Par MANSFIELD 04/28/2006 06063.80000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002586557 New Par MANSFIELD 04/28/2006 06600.00000 40-43-04.2 N OH MD WLT780 082-34-02.6 W 0002586557 New Par MANSFIELD 04/28/2006 11585.00000 40-43-04.2 N OH MD WQEL802 081-45-26.0 W 0002586562 FIBERTOWER
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265356A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265356A1.txt
  • Colorado 94.4 94.4 0.0 Connecticut 95.5 93.8 -1.7 Delaware 95.0 90.2 -4.8 District of Columbia 94.7 92.2 -2.5 Florida 85.5 90.9 5.4 * Georgia 88.9 86.8 -2.1 Hawaii 94.6 92.8 -1.8 Idaho 89.5 94.0 4.5 * Illinois 95.0 89.0 -6.0 Indiana 90.3 90.0 -0.3 Iowa 95.4 94.4 -1.0 Kansas 94.9 93.9 -1.0 Kentucky 86.9 91.0 4.1 * Louisiana 88.9 93.1 4.2 * Maine 90.7 95.2 4.5 * Maryland 96.3 92.8 -3.5 Massachusetts 94.3 94.3 0.0 Michigan 93.8 92.4 -1.4 Minnesota 96.4 96.6 0.3 Mississippi 82.4 91.8 9.4 * Missouri 92.1 95.3 3.2 * Montana 92.8 91.6 -1.2 Nebraska 94.0 93.6 -0.4 Nevada 89.4 90.5 1.1 New Hampshire 95.0 95.8 0.8 New Jersey 94.1 92.7 -1.4 New Mexico 85.3 89.6 4.3 *
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265358A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265358A1.txt
  • 17,471 16,792 16,918 10,513 9,271 9,061 9,176 9,016 9,234 14,299 14,123 13,920 13,415 13,480 7,275 6,482 6,714 6,607 6,714 6,643 10,746 10,395 10,425 10,320 10,298 12,746 10,966 11,435 12,337 13,209 13,459 22,296 22,648 21,655 21,713 21,064 56,941 49,682 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 * Current dollar equivalents are at the end of Table 4 58 Alabama 4.2 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.7 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.5 Hawaii 3.1 Oregon 3.1 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265386A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265386A1.txt
  • 05/08/2006 17820.00000 32-41-28.0 N TX MD WQBL897 097-05-53.0 W 0002601032 FIBERTOWER CORPORATION ARLINGTON 05/08/2006 17900.00000 32-41-28.0 N TX MD WQBL897 097-05-53.0 W 0002601032 FIBERTOWER CORPORATION ARLINGTON 05/08/2006 18040.00000 32-41-28.0 N UT MD WPQR889 112-12-08.0 W 0002601743 Nextel License Holdings 4, Inc. Salt Lake City 05/08/2006 06855.62500 40-39-09.0 N WA MD WQEU519 122-07-24.0 W 0002601964 T-MOBILE LICENSE LLC SNOHOMISH 05/08/2006 19385.00000 47-56-04.2 N WA MD WQEU519 122-07-24.0 W 0002601964 T-MOBILE LICENSE LLC SNOHOMISH 05/08/2006 23125.00000 47-56-04.2 N TX MD WPXA822 096-33-30.8 W 0002601969 FIBERTOWER CORPORATION MESQUITE 05/08/2006 10755.00000 32-45-43.3 N TX MD WPXA822 096-33-30.8 W 0002601969 FIBERTOWER CORPORATION MESQUITE 05/08/2006 10795.00000 32-45-43.3 N TX MD WPXA822 096-33-30.8 W 0002601969 FIBERTOWER CORPORATION MESQUITE 05/08/2006 19480.00000 32-45-43.3 N TX MD WPXA822 096-33-30.8 W 0002601969
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265627A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265627A1.txt
  • Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA AM WQAC882 080-09-02.4 W 0002622078 MEL WHEELER, INC. Roanoke 05/25/2006 00944.50000 37-11-56.5 N VA AM WQAC882 080-09-02.4 W 0002622078 MEL WHEELER, INC. Roanoke 05/25/2006 00944.75000 37-11-56.5 N MI MD WLD572 085-40-09.9 W 0002620983 CC LICENSES, LLC GRAND RAPIDS 05/22/2006 00945.50000 42-51-52.1 N ME MD WHY867 070-20-04.2 W 0002621125 ATLANTIC COAST RADIO, LLC Portland 05/22/2006 00948.50000 43-41-22.3 N PA MD WLP625 077-53-43.0 W 0002621511 2510 LICENSES, LLC STATE COLLEGE 05/22/2006 00951.50000 40-48-43.2 N OH MD WLF868 082-59-51.1 W 0002621561 STOP 26 RIVERBEND LICENSES, LLC, DCOLUMBUS 05/22/2006 00951.00000 39-57-47.2 N IN MD WLL523 086-09-10.0 W 0002621611 RADIO ONE OF INDIANA, LLC INDIANAPOLIS 05/22/2006 00951.87500 39-46-32.0 N ID MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265809A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265809A1.txt
  • (ALSAT) Page 8 of 16 E8543 SES-RWL-20060530-00902E Date Effective: 05/31/2006 Class of Station: Fixed Earth Stations Grant of Authority 07/11/2006 - 07/11/2021 Renewal NORTHWESTERN COLLEGE Nature of Service:Domestic Fixed Satellite Service 45 ° 2 ' 18.00 " N LAT. SITE ID: 1 3003 North Snelling Avenue, RAMSEY, ROSEVILLE, MN 93 ° 10 ' 9.00 " W LONG. LOCATION: COMTECH 1 4.2 meters ANTENNA ID: 56.80 dBW 5925.0000 - 6425.0000 MHz 200KF8E 55.90 dBW 5925.0000 - 6425.0000 MHz 358KG7W 66.90 dBW 5925.0000 - 6425.0000 MHz 1M70G7W 66.90 dBW 5925.0000 - 6425.0000 MHz 2M27G7W 66.90 dBW 5925.0000 - 6425.0000 MHz 3M40G7W 66.90 dBW 5925.0000 - 6425.0000 MHz 3M40G7W 66.90 dBW 5925.0000 - 6425.0000 MHz 6M90G7W 59.50 dBW 5925.0000 - 6425.0000 MHz 180KG7W 61.80
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266108A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266108A1.txt
  • 090-25-34.0 W 0002660378 Cellco Partnership Uniontown 06/22/2006 06595.00000 40-38-24.0 N IL MD WMQ581 090-25-34.0 W 0002660378 Cellco Partnership Uniontown 06/22/2006 06635.00000 40-38-24.0 N IL MD WMQ581 090-25-34.0 W 0002660378 Cellco Partnership Uniontown 06/22/2006 06660.00000 40-38-24.0 N IL MD WMQ581 090-25-34.0 W 0002660378 Cellco Partnership Uniontown 06/22/2006 06675.00000 40-38-24.0 N IL MD WPNF218 090-42-42.4 W 0002660379 Cellco Partnership ROSEVILLE 06/22/2006 06755.00000 40-43-04.2 N IL MD WPNF218 090-42-42.4 W 0002660379 Cellco Partnership ROSEVILLE 06/22/2006 06805.00000 40-43-04.2 N IL MD WPNF218 090-42-42.4 W 0002660379 Cellco Partnership ROSEVILLE 06/22/2006 06805.00000 40-43-04.2 N IL MD WPNF218 090-42-42.4 W 0002660379 Cellco Partnership ROSEVILLE 06/22/2006 06820.00000 40-43-04.2 N MA MD WQFA959 071-33-25.9 W 0002660413 FIBERTOWER CORPORATION Hopkinton 06/22/2006 17880.00000 42-14-35.9 N PR MD WPSM328 066-02-27.0 W 0002660463 SprintCom,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266222A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266222A1.txt
  • - 4200.0000 MHz 10M3G7W Points of Communication: 1 - ALSAT - (ALSAT) E060245 SES-REG-20060622-01045E Class of Station: Fixed Earth Stations Registration NORTHERN ILLINOIS UNIVERSITY Nature of Service:Domestic Fixed Satellite Service 41 ° 56 ' 20.50 " N LAT. SITE ID: 1 801 NORTH FIRST STREET (WNIJ), DEKALB, DEKALB, IL 88 ° 45 ' 2.10 " W LONG. LOCATION: DH SATELLITE 4.2 M. 4.2 meters ANTENNA ID: 4.2 M. DIGITAL AUDIO CARRIER 3700.0000 - 4200.0000 MHz 10M3G7W DIGITAL AUDIO CARRIER 3700.0000 - 4200.0000 MHz 30K0F1D Points of Communication: 1 - ALSAT - (ALSAT) E060248 SES-REG-20060627-01072E Class of Station: Fixed Earth Stations Registration Spokane Public Radio Inc Nature of Service:Fixed Satellite Service 47 ° 40 ' 45.60 " N LAT. SITE ID: 1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266245A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266245A1.txt
  • N Page 15 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI MD KNKQ320 085-41-03.4 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andGOULD CITY 06/29/2006 46-05-59.0 N MI MD KNKQ320 085-59-35.7 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andGrand Marais 06/29/2006 46-38-28.9 N MI MD KNKQ320 084-28-04.2 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andKinross 06/29/2006 46-15-47.1 N MI MD KNKQ320 086-29-18.5 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andMANISTIQUE 06/29/2006 45-58-00.9 N MI MD KNKQ320 086-29-18.5 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andMANISTIQUE 06/29/2006 45-58-00.9 N MI MD KNKQ320 085-33-45.4 W 0002668130 ALLTEL Wireless of Michigan RSA #1 andNEWBERRY 06/29/2006 46-18-53.0 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266349A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266349A1.txt
  • Latitude State Longitude Loc./ Path ## Ant. PW - Public Safety Pool, Conventional Public Safety & Critical Infrastructure Division 06/07/2006 WPXZ607 FXO OMAHA, CITY OF 458.81250000 OMAHA 41-13-15.5 N NE 95-55-14.3 W 3 1 06/07/2006 WPXZ607 FXO OMAHA, CITY OF 458.81250000 OMAHA 41-14-52.6 N NE 95-55-6.8 W 4 1 06/07/2006 WPXZ607 FXO OMAHA, CITY OF 458.81250000 OMAHA 41-13-26.8 N NE 95-55-4.2 W 5 1 06/07/2006 WPXZ607 FXO OMAHA, CITY OF 458.81250000 OMAHA 41-13-8.8 N NE 95-55-22.9 W 6 1 06/04/2006 WQCV530 MO LAS VEGAS METROPOLITAN POLICE 155.97000000 -- NV -- 2 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. YG - Industrial/Business Pool, Trunked Public Safety & Critical Infrastructure Division
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266593A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266593A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266593A1.txt
  • line. For the first time in our data collection, the increase in ADSL lines exceeded the increase in cable modem connections. ADSL increased by 3.2 million lines during the second half of 2005 compared to an increase of 1.6 million lines for cable modem service. For the full year, ADSL increased by 5.7 million lines compared to an increase of 4.2 million lines for cable modem service. Advanced Services Lines Advanced services lines, which deliver services at speeds exceeding 200 kbps in both directions, increased by 15% during the second half of 2005, from 37.3 million to 42.8 million, compared to a 29% increase, from 28.9 million to 37.3 million lines, during the first half of 2005. For the full twelve
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266595A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266595A1.txt
  • counts by state. State * Data withheld to maintain firm confidentiality. Some data have been revised. Zero 44.0%38.0%31.3% 21.0% 21.9% 17.4% 18.4% One 16.8 16.8 19.3 15.3 15.3 10.5 11.4 Two 10.4 10.0 10.4 9.8 11.6 7.6 7.6 Three 7.2 7.7 6.7 7.5 7.6 6.0 6.2 Four 5.5 6.1 6.3 6.1 5.7 4.8 4.7 Five 4.0 4.5 5.2 5.4 5.2 4.2 4.1 Six 3.0 3.8 4.4 5.6 4.4 3.4 3.6 Seven 2.3 2.9 3.5 5.4 4.2 3.1 3.3 Eight 1.7 2.2 2.9 5.4 3.7 3.1 2.9 Nine 1.4 2.1 2.6 4.0 3.2 2.8 2.7 Ten or More 3.7 5.9 7.3 14.7 17.3 36.9 35.0 Zero 11.8% 8.8% 5.8% 3.0% 3.1% 2.2% 2.4% One 10.6 8.5 8.2 4.8 4.6 2.1 2.3 Two
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266596A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266596A1.txt
  • the first time in our data collection, the increase in asymmetric DSL (ADSL) lines exceeded the increase in cable modem connections. ADSL increased by 3.2 million lines during the second half of 2005 compared to an increase of 1.6 million lines for cable modem service. For the full year, ADSL increased by 5.7 million lines compared to an increase of 4.2 million lines for cable modem service. See Table 1. (Continued from previous page) the end user of the retail high-speed Internet-access service is billed by the incumbent LEC, its ISP affiliate, another affiliate, or its billing agent, or by an unaffiliated ISP that has incorporated the incumbent LEC's high-speed service into a premium Internet-access service marketed under the ISP's own
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266710A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266710A1.txt
  • Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA AM 081-46-56.4 W 0002573805 STATON BROADCASTING, INC. Statesboro 07/26/2006 00950.50000 32-26-56.6 N OH MD WPNE582 082-13-37.0 W 0002692521 LEGEND COMMUNICATIONS OF WESTGallipolis 07/25/2006 00947.50000 38-48-18.0 N CO MD WPNH601 108-34-00.4 W 0002692758 CUMULUS LICENSING LLC GRAND JUNCTION 07/25/2006 00944.15000 39-04-46.3 N WI MD WCD925 088-35-04.2 W 0002692773 CUMULUS LICENSING LLC OSHKOSH 07/25/2006 00945.87500 44-00-50.4 N WI MD WCD925 088-35-04.2 W 0002692773 CUMULUS LICENSING LLC OSHKOSH 07/25/2006 00949.50000 44-00-50.4 N WI MD WLO584 088-35-04.2 W 0002692775 CUMULUS LICENSING LLC Oshkosh 07/25/2006 00945.50000 44-00-50.4 N VA MD WGH969 076-23-05.7 W 0002693958 HAMPTON RADIO II, INC. HAMPTON 07/26/2006 00947.00000 37-04-08.8 N OK NE 096-58-59.1 W 0002691042 DFWU, INC.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266832A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266832A1.txt
  • ALSAT - (ALSAT) E060245 SES-REG-20060622-01045E Date Effective: 08/07/2006 Class of Station: Fixed Earth Stations Grant of Authority 06/22/2006 - 06/22/2021 Registration NORTHERN ILLINOIS UNIVERSITY Nature of Service:Domestic Fixed Satellite Service 41 ° 56 ' 20.50 " N LAT. SITE ID: 1 801 NORTH FIRST STREET (WNIJ), DEKALB, DEKALB, IL 88 ° 45 ' 2.10 " W LONG. LOCATION: DH SATELLITE 4.2 M. 4.2 meters ANTENNA ID: 4.2 M. DIGITAL AUDIO CARRIER 3700.0000 - 4200.0000 MHz 10M3G7W DIGITAL AUDIO CARRIER 3700.0000 - 4200.0000 MHz 30K0F1D Points of Communication: 1 - ALSAT - (ALSAT) E060248 SES-REG-20060627-01072E Date Effective: 08/07/2006 Class of Station: Fixed Earth Stations Grant of Authority 06/27/2006 - 06/27/2021 Registration Spokane Public Radio Inc Nature of Service:Domestic Fixed Satellite Service 47
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266914A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266914A1.txt
  • SouthwesPAYSON 08/11/2006 06197.24000 34-15-13.0 N AZ MD WMV995 111-18-41.1 W 0002710594 ALLTEL Communications of the SouthwesPAYSON 08/11/2006 06845.00000 34-15-13.0 N AZ MD WMV995 111-18-41.1 W 0002710594 ALLTEL Communications of the SouthwesPAYSON 08/11/2006 10602.50000 34-15-13.0 N AZ MD WPNE731 111-11-34.4 W 0002710597 ALLTEL Communications of the SouthwesPAYSON 08/11/2006 10667.50000 34-17-15.5 N FL NE 082-27-40.1 W 0002703014 FIBERTOWER CORPORATION TAMPA 08/04/2006 19380.00000 28-03-04.2 N FL NE 082-22-17.2 W 0002703015 FIBERTOWER CORPORATION Tampa 08/04/2006 18060.00000 28-03-17.1 N FL NE 082-25-13.0 W 0002703016 FIBERTOWER CORPORATION TAMPA 08/04/2006 11285.00000 28-02-43.0 N FL NE 082-27-07.0 W 0002703017 FIBERTOWER CORPORATION TAMPA 08/04/2006 10795.00000 28-02-58.0 N FL NE 082-27-07.0 W 0002703017 FIBERTOWER CORPORATION TAMPA 08/04/2006 17820.00000 28-02-58.0 N FL NE 082-40-39.0 W 0002703094 FIBERTOWER CORPORATION Saint Petersburg 08/04/2006 18060.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267225A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267225A1.txt
  • Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VT NE 072-30-54.7 W 0002731911 CENTRAL VERMONT COMMUNICATIONWoodstock 08/31/2006 00157.74000 43-37-31.8 N MA NE 072-42-12.0 W 0002731918 CENTRAL VERMONT COMMUNICATIONAgawam 08/31/2006 00157.74000 42-05-05.0 N NH NE 071-34-14.0 W 0002731918 CENTRAL VERMONT COMMUNICATIONConcord 08/31/2006 00157.74000 43-14-06.0 N VT NE 072-21-34.4 W 0002731918 CENTRAL VERMONT COMMUNICATIONHardwick 08/31/2006 00157.74000 44-31-04.2 N NH NE 071-58-52.3 W 0002731918 CENTRAL VERMONT COMMUNICATIONNorth Haverhill 08/31/2006 00157.74000 44-06-49.2 N ME NE 070-15-35.0 W 0002731918 CENTRAL VERMONT COMMUNICATIONPortland 08/31/2006 00157.74000 43-39-05.3 N VT NE 072-55-10.4 W 0002731918 CENTRAL VERMONT COMMUNICATIONStratton 08/31/2006 00157.74000 43-05-48.3 N NH NE 071-51-24.0 W 0002731922 CENTRAL VERMONT COMMUNICATIONAndover 08/31/2006 00157.74000 43-23-00.0 N VT NE 072-15-52.4 W 0002731922 CENTRAL VERMONT COMMUNICATIONEast Corinth 08/31/2006
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267393A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267393A1.txt
  • Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV NE 114-55-56.3 W 0002742090 NEW CINGULAR WIRELESS SERVICESLAS VEGAS 09/06/2006 11405.00000 36-19-12.7 N CA NE 118-09-34.3 W 0002742518 T-MOBILE LICENSE LLC INDEPENDENCE 09/07/2006 10617.50000 36-47-54.8 N OR NE 123-56-21.8 W 0002742578 T-MOBILE LICENSE LLC ROCKAWAY BEAC 09/07/2006 17825.00000 45-39-04.2 N OR NE 123-54-15.7 W 0002742579 T-MOBILE LICENSE LLC Rockaway Beach 09/07/2006 19385.00000 45-40-26.4 N PR NE 066-08-49.7 W 0002742580 SPRINTCOM, INC. (PUERTO RICO) BAYAMON 09/07/2006 11627.50000 18-23-10.3 N WI NE 088-56-37.0 W 0002742818 UNITED STATES CELLULAR OPERATINMILTON 09/07/2006 06765.00000 42-48-36.0 N TX NE 097-00-03.7 W 0002743111 DALLAS MTA, LP LEXINGTON 09/07/2006 06755.62500 30-31-31.9 N WY NE 106-52-32.7 W 0002743121
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267604A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267604A1.txt
  • Inc. Carlsbad 09/18/2006 06375.14000 32-31-34.0 N NM NE 104-16-42.0 W 0002754548 Plateau Telecommunications, Inc. Carlsbad 09/18/2006 06034.15000 32-26-17.0 N LA NE 089-34-11.1 W 0002755536 Trillion Partners, Inc. Buras 09/19/2006 19480.00000 29-22-03.8 N LA NE 089-34-11.1 W 0002755536 Trillion Partners, Inc. Buras 09/19/2006 19520.00000 29-22-03.8 N LA NE 089-55-46.1 W 0002755613 Trillion Partners, Inc. Braithwaite 09/19/2006 17840.00000 29-38-37.4 N LA NE 089-43-04.2 W 0002755649 Trillion Partners, Inc. Port Sulphur 09/19/2006 19400.00000 29-30-01.0 N LA NE 089-43-04.2 W 0002755649 Trillion Partners, Inc. Port Sulphur 09/19/2006 21875.00000 29-30-01.0 N CA NE 119-36-33.0 W 0002755771 T-MOBILE LICENSE LLC Hanford 09/19/2006 17825.00000 36-12-39.0 N CA NE 119-40-06.0 W 0002755774 T-MOBILE LICENSE LLC HANFORD 09/19/2006 19385.00000 36-19-16.0 N PR NE 066-04-53.6 W 0002755777 SPRINTCOM, INC. (PUERTO RICO)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268047A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268047A1.txt
  • N VA NE 077-25-59.0 W 0002786790 FiberTower Network Services Corp. INDEPENDENT HIL 10/16/2006 21975.00000 38-39-26.0 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE 077-05-58.9 W 0002786882 FiberTower Network Services Corp. ARLINGTON 10/16/2006 23020.00000 38-53-44.5 N VA NE 077-08-04.2 W 0002786883 FiberTower Network Services Corp. FALLS CHURCH 10/16/2006 23070.00000 38-51-46.1 N VA NE 077-05-25.6 W 0002786884 FiberTower Network Services Corp. ALEXANDRIA 10/16/2006 23070.00000 38-48-18.4 N VA NE 077-05-25.6 W 0002786884 FiberTower Network Services Corp. ALEXANDRIA 10/16/2006 23120.00000 38-48-18.4 N VA NE 077-05-25.6 W 0002786884 FiberTower Network Services Corp. ALEXANDRIA 10/16/2006 23170.00000 38-48-18.4 N VA NE 077-06-36.0 W 0002786885 FiberTower
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268576A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268576A1.txt
  • Wichita 11/15/2006 00948.50000 37-43-19.0 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL AM WQFZ444 089-37-20.1 W 0002749029 IM IL LICENSES, LLC Peoria 11/14/2006 00946.50000 40-44-19.3 N IL AM WQFZ444 089-37-20.1 W 0002749029 IM IL LICENSES, LLC Peoria 11/14/2006 00946.50000 40-44-19.3 N AL AM 088-09-04.2 W 0002816798 KINGDOM RADIO OF CHATTANOOGA, Aliceville 11/15/2006 00944.75000 33-07-45.5 N MT MD WLF676 108-30-44.5 W 0002821373 NEW NORTHWEST BROADCASTERS, LBILLINGS 11/16/2006 00949.92500 45-46-51.8 N ID MD WBX241 114-28-18.1 W 0002821928 CITICASTERS LICENSES, L.P. TWIN FALLS 11/17/2006 00950.50000 42-32-33.3 N MN MD WPZR402 092-05-37.7 W 0002822612 RED ROCK RADIO CORP. DULUTH 11/17/2006 00951.87500 46-46-50.8 N WV NE 080-42-41.7 W 0002814631
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268625A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268625A1.pdf
  • must be periodically calibrated so as to provide reliable indications of transmitter operating parameters with a known degree of accuracy.'' During the inspection, the agent determined that WSNR failed to calibrate its remote monitoring system so that it provided reliable indications of the transmitter's common point current. The station's remote monitoring system indicated a common point current value that was 4.2 percent below the value indicated on the transmitter's common point current meter. Entries in the station log over several months showed similar inaccurate readings. 47 C.F.R. § 73.1590(a)(6): ``The licensee of each AM, FM, TV and Class A TV station, except licensees of Class D non-commercial educational FM stations authorized to operate with 10 watts or less output power, must
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268813A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268813A1.txt
  • 41-01-38.0 N NE AM 095-54-01.0 W 0002822575 Cass County Of, Sheriffs Office Plattsmouth 11/29/2006 00943.17500 41-01-38.0 N NE AM 095-54-01.0 W 0002822576 Cass County Of, Sheriffs Office Plattsmouth 11/29/2006 00933.77500 41-01-38.0 N NE AM 095-54-01.0 W 0002822576 Cass County Of, Sheriffs Office Plattsmouth 11/29/2006 00942.77500 41-01-38.0 N NV AM 118-43-46.0 W 0002833253 State of Nevada Department of InformatioLovelock 12/01/2006 06034.15000 40-07-04.2 N NV AM 118-43-46.0 W 0002833253 State of Nevada Department of InformatioLovelock 12/01/2006 06152.75000 40-07-04.2 N NV AM 117-49-48.9 W 0002833271 State of Nevada Department of InformatioLovelock 12/01/2006 06286.19000 40-04-46.0 N NV AM 117-49-48.9 W 0002833271 State of Nevada Department of InformatioLovelock 12/01/2006 06345.49000 40-04-46.0 N NV AM 119-55-42.4 W 0002833365 State of Nevada Department of InformatioReno 12/01/2006 06256.54000 39-35-21.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269066A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269066A1.txt
  • Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WBK251 116-56-13.0 W 0002835944 MIDWEST TELEVISION, INC. SAN DIEGO 12/11/2006 13050.00000 - 13075.00000 32-41-48.1 N CA AM WLI574 116-50-06.1 W 0002835960 MIDWEST TELEVISION, INC. ESCONDIDO 12/11/2006 06887.50000 33-18-36.1 N CA AM WLI574 116-50-06.1 W 0002835960 MIDWEST TELEVISION, INC. ESCONDIDO 12/11/2006 06887.50000 33-18-36.1 N PA MD WGV708 080-01-04.2 W 0002849897 CBS BROADCASTING INC. PITTSBURGH 12/15/2006 06925.00000 - 06950.00000 40-29-37.2 N PA MD WGV707 080-01-04.2 W 0002849963 CBS BROADCASTING INC. PITTSBURGH 12/15/2006 06875.00000 - 06900.00000 40-29-37.2 N CA NE 117-08-10.1 W 0002843768 MIDWEST TELEVISION, INC. San Diego 12/11/2006 12925.00000 - 12950.00000 32-46-49.1 N CA NE 116-58-15.3 W 0002843778 MIDWEST TELEVISION, INC. Ramona 12/11/2006 12925.00000 - 12950.00000 33-00-31.2 N FL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269191A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269191A1.txt
  • 12/21/2006 11285.00000 44-19-07.7 N WI NE 089-48-59.8 W 0002858408 NSIGHTTEL WIRELESS LLC Saratoga 12/21/2006 10755.00000 44-18-19.6 N WI NE 089-48-59.8 W 0002858408 NSIGHTTEL WIRELESS LLC Saratoga 12/21/2006 10835.00000 44-18-19.6 N WI NE 089-48-02.7 W 0002858412 NSIGHTTEL WIRELESS LLC Wisconsin Rapids 12/21/2006 11215.00000 44-22-26.0 N WI NE 089-48-02.7 W 0002858412 NSIGHTTEL WIRELESS LLC Wisconsin Rapids 12/21/2006 11325.00000 44-22-26.0 N WY NE 106-42-04.2 W 0002859224 Union Telephone Company Buffalo 12/22/2006 17810.00000 44-22-42.8 N WY NE 110-58-50.0 W 0002859233 Union Telephone Company Evanston 12/22/2006 19480.00000 41-15-23.5 N UT NE 112-04-22.7 W 0002859766 Beehive Telephone Company, Inc. Monroe 12/22/2006 06004.50000 38-32-11.5 N CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KNKA273
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A1.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements per Student ..........................................
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A11.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A11.txt
  • Average Switch Downtime in Seconds per Switch* For All Events 2,500.6 0.0 30.1 901.8 1,660.8 483.1 3,299.1 8,919.4 For Unscheduled Events Over 2 Minutes 2,500.6 NA NA 607.0 115.8 483.1 3,201.5 8,919.4 For Unscheduled Downtime More Than 2 Minutes Number of Occurrences or Events 24 0 0 14 3 15 179 29 Events per Hundred Switches 9.9 0.0 0.0 6.8 4.2 5.5 13.3 10.0 Events per Million Access Lines 30.75 0.00 0.00 11.21 3.63 64.16 24.77 58.74 Average Outage Duration in Minutes 422.0 NA NA 148.1 46.3 146.0 400.9 1491.7 Average Lines Affected per Event in Thousands 4.6 NA NA 2.8 2.8 0.4 6.0 1.3 Outage Line-Minutes per Event in Thousands 1,557.9 NA NA 320.2 71.9 67.7 2,147.6 907.8 Outage Line-Minutes
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A2.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements per Student ..........................................
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A3.txt
  • reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. Through 1996, these revenues have been disaggregated by assuming that the end- user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. Significant amounts of enhanced services, billing and collection,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A5.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A5.txt
  • 31.0 66.8 45.7 35.3 315.7 Total 1,136.6 11.6 - 273.4 274.8 715.8 641.7 414.4 3,468.4 ILECs 1,052.1 12.3 3.8 221.3 0.0 953.9 581.9 360.4 3,185.7 2005 CETCs 166.8 2.9 0.6 70.6 -0.2 224.4 109.1 64.4 638.5 Total 1,218.9 15.2 4.4 291.8 -0.2 1,178.3 691.0 424.8 3,824.2 ILECs 1,047.2 16.0 0.8 213.6 - 950.4 560.8 384.0 3,172.7 2006 * CETCs 237.2 4.2 1.0 118.8 - 280.3 96.4 82.7 820.4 Total 1,284.3 20.2 1.8 332.4 - 1,230.6 657.2 466.7 3,993.2 Note: Details may not appear to add to totals due to rounding. ILECs are incumbent local exchange carriers. CETCs are competitive eligible telecommunications carriers. -Support mechanism did not exist in that year. *Estimate for 2006 based on USAC projections. Source: Universal Service Administrative
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A6.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A6.txt
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for Funding Years 2003, 2004 and 2005. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A9.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A9.txt
  • 1955 - 2005 1995 - 2005 CPI All Items 4.1 % 2.5 % CPI All Services 5.0 3.2 CPI Telephone Services ** 1.7 -0.2 CPI Major Categories: - Food & Beverages * 2.5 - Housing * 2.8 - Apparel 2.1 -1.0 - Transportation 3.9 2.3 - Medical Care 5.9 3.9 - Recreation * 1.5 - Other Goods & Services * 4.2 CPI Public Transportation 5.1 2.1 CPI Utility Natural Gas Service 5.5 7.7 CPI Electricity 3.4 1.5 CPI Sewer & Water Maintenance 5.6 3.7 CPI Postage 4.7 1.8 *** Source: Bureau of Labor Statistics. Chart 7.1 The CPI telephone service index was revised in December of 1997. Table 7.1 Long-Term Changes for Various Price Indices (Annual Rates of Change) Series not
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269304A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269304A1.txt
  • Location Termination Pending Call Sign Termination Licensee Name Location Date # City Latitude State Longitude Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. CF - Common Carrier Fixed Point to Point Microwave Broadband Division 11/24/2006 WPOR717 FXO LOS ANGELES SMSA LIMITED PARTNERSHIP 17835.00000000 WESTMINSTE 33-44-46.0 N CA 118-0-4.2 W 2 1 11/25/2006 WPZM783 FXO Centennial Puerto Rico License Corp. 18090.00000000 Fajardo 18-19-49.0 N PR 65-40-16.4 W 2 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. IG - Industrial/Business Pool, Conventional Mobility Division 11/28/2006 WPDJ569 MO WYETH PHARMACEUTICALS COMPANY 451.23750000 -- -- 2 1 11/25/2006 WPGB331 FB FARMERS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269393A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269393A1.txt
  • 11405.00000 38-51-18.0 N VA NE 077-22-25.0 W 0002868522 FiberTower Network Services Corp. HERNDON 01/04/2007 10875.00000 38-55-36.0 N VA NE 077-22-25.0 W 0002868522 FiberTower Network Services Corp. HERNDON 01/04/2007 10915.00000 38-55-36.0 N VA NE 077-25-20.1 W 0002868523 FiberTower Network Services Corp. HERNDON 01/04/2007 11365.00000 38-56-12.8 N WY NE 110-58-50.0 W 0002868629 Union Telephone Company Evanston 01/04/2007 19480.00000 41-15-23.5 N WY NE 106-42-04.2 W 0002868664 Union Telephone Company Buffalo 01/04/2007 17810.00000 44-22-42.8 N TX NE 096-51-13.6 W 0002869271 FIBERTOWER NETWORK SERVICES CODallas 01/04/2007 21970.00000 32-59-19.8 N TX NE 096-40-35.9 W 0002869274 FIBERTOWER NETWORK SERVICES COGarland 01/04/2007 21925.00000 32-54-20.2 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269508A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269508A1.txt
  • 084-38-37.0 W 0002872032 BOONE COUNTY PUBLIC SAFETY COMFLORENCE 01/08/2007 06256.54000 38-59-55.0 N KY MD WPRU716 084-38-37.0 W 0002872032 BOONE COUNTY PUBLIC SAFETY COMFLORENCE 01/08/2007 10648.12500 38-59-55.0 N KY MD WPRU716 084-38-37.0 W 0002872032 BOONE COUNTY PUBLIC SAFETY COMFLORENCE 01/08/2007 10648.12500 38-59-55.0 N KY MD WPRU716 084-38-37.0 W 0002872032 BOONE COUNTY PUBLIC SAFETY COMFLORENCE 01/08/2007 11365.00000 38-59-55.0 N AR MD WNEQ913 092-30-04.2 W 0002872033 ARKANSAS, STATE OF LITTLE ROCK 01/08/2007 05945.20000 34-48-03.6 N AR MD WNEQ913 092-30-04.2 W 0002872033 ARKANSAS, STATE OF LITTLE ROCK 01/08/2007 05974.85000 34-48-03.6 N AR MD WNEQ913 092-30-04.2 W 0002872033 ARKANSAS, STATE OF LITTLE ROCK 01/08/2007 06034.15000 34-48-03.6 N AR MD WNEQ913 092-30-04.2 W 0002872033 ARKANSAS, STATE OF LITTLE ROCK 01/08/2007 06063.80000 34-48-03.6 N AR MD WNEQ913 092-30-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270046A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270046A1.txt
  • MD NE 076-51-08.2 W 0002888137 CLEARWIRE SPECTRUM HOLDINGS II LAUREL 01/24/2007 17800.00000 39-02-43.2 N MD NE 076-51-08.2 W 0002888137 CLEARWIRE SPECTRUM HOLDINGS II LAUREL 01/24/2007 21875.00000 39-02-43.2 N MD NE 076-50-30.2 W 0002888138 CLEARWIRE SPECTRUM HOLDINGS II FT MEADE 01/24/2007 23025.00000 39-05-38.5 N MD NE 076-50-30.2 W 0002888138 CLEARWIRE SPECTRUM HOLDINGS II FT MEADE 01/24/2007 23075.00000 39-05-38.5 N MD NE 076-53-04.2 W 0002888139 CLEARWIRE SPECTRUM HOLDINGS II Laurel 01/24/2007 21825.00000 39-05-55.1 N MD NE 076-53-04.2 W 0002888139 CLEARWIRE SPECTRUM HOLDINGS II Laurel 01/24/2007 21925.00000 39-05-55.1 N MD NE 076-56-32.0 W 0002888140 CLEARWIRE SPECTRUM HOLDINGS II SILVER SPRING 01/24/2007 21875.00000 39-05-09.7 N MD NE 076-56-32.0 W 0002888140 CLEARWIRE SPECTRUM HOLDINGS II SILVER SPRING 01/24/2007 21975.00000 39-05-09.7 N MD NE 076-56-05.6 W 0002888141
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270308A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270308A1.txt
  • Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City LA MD WQFN976 091-11-22.7 W 0002900257 Trillion Partners, Inc. Tallulah 02/02/2007 23035.00000 32-24-22.5 N AZ NE 111-37-48.6 W 0002893967 SPARKPLUG SOUTHWEST, LLC PAGE 01/29/2007 06815.00000 36-41-52.0 N AZ NE 110-52-12.3 W 0002893993 SPARKPLUG SOUTHWEST, LLC PAGE 01/29/2007 06725.62500 37-02-04.6 N VA NE 077-23-04.2 W 0002894048 FiberTower Network Services Corp. Prince William 01/29/2007 10795.00000 38-42-37.4 N AZ NE 111-27-14.8 W 0002894119 SPARKPLUG SOUTHWEST, LLC PAGE 01/29/2007 06555.62500 36-54-29.5 N AZ NE 111-27-14.8 W 0002894119 SPARKPLUG SOUTHWEST, LLC PAGE 01/29/2007 06655.00000 36-54-29.5 N VA NE 077-28-45.8 W 0002894444 Telecom Transport Management, Inc. Richmond 01/29/2007 19410.00000 37-29-02.0 N VA NE 077-25-57.9 W 0002895176 Telecom Transport Management,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270407A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270407A1.txt
  • 143,341,581 2.8 142,367,463 2.0 1993 148,106,159 3.3 147,033,132 3.3 1994 153,447,946 3.6 151,543,061 3.1 1995 159,658,662 4.0 158,152,644 4.4 1996 166,445,580 4.3 165,350,308 4.6 1997 173,866,799 4.5 173,857,193 5.1 1998 179,849,045 3.4 180,516,161 3.8 1999 189,397,096 185,002,911 2.9 186,594,497 3.4 2000 192,432,431 1.6% 188,499,586 1.9 187,581,092 0.5 2001 191,570,800 -0.5 185,587,160 -1.5 179,811,283 -4.1 2002 189,250,143 -1.2 180,095,333 -3.0 172,265,210 -4.2 2003 182,933,281 -3.3 173,140,710 -3.9 161,376,638 -6.3 2004 177,690,711 -2.8 165,978,892 -4.1 154,590,517 -4.2 2005 175,160,940 -1.4 157,041,487 -5.4 147,661,287 -4.5 NA indicates not available. 1 Include end-user switched access lines for competitive local exchange carriers (CLECs) and incumbent local exchange carriers (ILECs) as reported in the FCC Form 477. Carriers with greater than 10,000 lines in a state were
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270762A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270762A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270762A1.txt
  • travel across the country to participate in forums like this, I hear complaints about hyper-commercialism, rampant homogenization, and an unforgivable lack of women and minority ownership, employment, and participation. Women make up over half of the U.S. population, but they own less than 5 percent of all television stations. And, minority ownership of radio and television stations is dismal: only 4.2 percent of radio stations and 1.5 percent of TV stations are owned by African Americans, Latinos and Asians. In Harrisburg, Hispanics alone comprise nearly 12 percent of the population and African-Americans account for 55 percent, yet neither group owns a radio or television station. This lack of diversity may account for the inadequate coverage and a lack of understanding of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270855A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270855A1.txt
  • correction continues beyond the date of publication of this report, as new problems are identified. Reporting companies frequently re-file data, not only for the current reporting period, but also occasionally for previous reporting periods. Hence, users of the quality of service report data may find some inconsistencies with data extracted from the ARMIS database at a later or earlier date. 4.2 Commission Recalculation of Holding Company Aggregate Statistics Commission staff do not typically delete or adjust company-filed data for presentation in the quality of service report, except for recalculating holding company totals and other data aggregates as described in Section 3.1. Recalculated aggregates appear in the tables of the quality of service report. These may not match corresponding company-filed totals and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271177A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271177A1.txt
  • Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KNKA273 121-31-58.1 W 0002856894 SACRAMENTO VALLEY LIMITED PARTNWalnut Grove 03/01/2007 38-13-44.7 N MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL MD WPXW847 081-51-18.3 W 0002929779 SUN BROADCASTING, INC. Ft. Myers 02/28/2007 05945.20000 26-39-04.2 N MN MD WQDP551 092-06-56.6 W 0002933028 Fixed Wireless Holdings, LLC Superior 03/02/2007 23070.00000 46-43-20.1 N MN MD WQDP551 092-06-56.6 W 0002933028 Fixed Wireless Holdings, LLC Superior 03/02/2007 23120.00000 46-43-20.1 N TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL MD WPXV752 081-45-47.3 W 0002929780
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271463A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271463A1.txt
  • 03/09/2007 06382.55000 34-52-50.9 N CA MD WPNL387 115-04-05.9 W 0002943728 Los Angeles SMSA Limited PartnershipGOFFS 03/09/2007 06412.20000 34-52-50.9 N NC NE 080-50-21.0 W 0002934157 Conterra Ultra Broadband Charlotte 03/05/2007 17760.00000 35-05-18.0 N NC NE 080-52-54.1 W 0002934163 Conterra Ultra Broadband CHARLOTTE 03/05/2007 19320.00000 35-04-36.1 N SC NE 081-02-31.1 W 0002934176 Conterra Ultra Broadband Columbia 03/05/2007 23075.00000 33-59-34.9 N SC NE 081-02-04.2 W 0002934207 CONTERRA ULTRA BROADBAND COLUMBIA 03/05/2007 21875.00000 34-00-17.5 N PR NE 066-18-22.8 W 0002934347 SprintCom, Inc. (Puerto Rico) Corozal 03/05/2007 11137.50000 18-16-59.0 N CO NE 105-04-42.8 W 0002934403 LP Broadband Inc. Berthoud 03/05/2007 17920.00000 40-18-23.0 N OK NE 097-52-53.2 W 0002935603 Cellular Network Partnership, A Limited PaEnid 03/05/2007 06226.89000 36-24-18.1 N OK NE 097-52-53.2 W 0002935603 Cellular Network Partnership,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271635A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271635A1.txt
  • W 0002952474 CENTRAL WYOMING COLLEGE POWELL 03/16/2007 07037.50000 44-35-13.5 N WY NE 108-46-07.8 W 0002952479 CENTRAL WYOMING COLLEGE POWELL 03/16/2007 06882.50000 44-45-44.9 N WY NE 104-41-46.4 W 0002952485 CENTRAL WYOMING COLLEGE WHEATLAND 03/16/2007 06962.50000 42-02-35.9 N WY NE 104-41-46.4 W 0002952492 CENTRAL WYOMING COLLEGE WHEATLAND 03/16/2007 06937.50000 42-02-35.9 N WY NE 104-49-02.3 W 0002952496 CENTRAL WYOMING COLLEGE CHUGWATER 03/16/2007 07012.50000 41-46-04.2 N WY NE 106-09-03.1 W 0002952782 CENTRAL WYOMING COLLEGE EDGERTON 03/16/2007 07037.50000 43-29-45.9 N WY NE 106-21-36.0 W 0002952787 CENTRAL WYOMING COLLEGE CASPER 03/16/2007 07112.50000 42-44-26.0 N TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WQGP537 118-13-05.0 W 0002840560 Adelman, Robert D Quartz
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272066A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272066A1.txt
  • N IN MD KSE84 086-09-53.0 W 0002965468 Duke Energy Corporation WESTFIELD 03/26/2007 06675.00000 40-02-47.0 N IN MD KSE84 086-09-53.0 W 0002965468 Duke Energy Corporation WESTFIELD 03/26/2007 06695.00000 40-02-47.0 N IN MD KSE88 085-58-37.9 W 0002965592 Duke Energy Corporation NOBLESVILLE 03/26/2007 06775.00000 40-05-55.1 N IN MD KSE88 085-58-37.9 W 0002965592 Duke Energy Corporation NOBLESVILLE 03/26/2007 06775.00000 40-05-55.1 N IN MD WPQQ752 086-10-04.2 W 0002965642 Duke Energy Corporation Sheridan 03/26/2007 06810.00000 40-05-45.7 N IN MD WPQQ752 086-10-04.2 W 0002965642 Duke Energy Corporation Sheridan 03/26/2007 06810.00000 40-05-45.7 N IN MD WPQQ645 086-09-53.9 W 0002965647 Duke Energy Corporation WESTFIELD 03/26/2007 06650.00000 40-02-47.7 N IN MD KSC33 086-23-18.0 W 0002965649 Duke Energy Corporation PLAINFIELD 03/26/2007 06286.19000 39-42-34.0 N IN MD KSC33 086-23-18.0 W 0002965649 Duke Energy
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272240A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272240A1.txt
  • UNIVERSITY Tupper Lake 03/30/2007 00944.25000 44-09-35.2 N NY NE 075-09-11.7 W 0002974466 THE ST. LAWRENCE UNIVERSITY Canton 03/30/2007 00945.00000 44-35-45.2 N KS NE 097-08-49.3 W 0002974482 TAYLOR COMMUNICATIONS, INC. CLAY CENTER 03/30/2007 00946.00000 39-22-52.9 N WA NE 120-33-47.7 W 0002978191 CAPSTAR TX LIMITED PARTNERSHIPYAKIMA 04/03/2007 00946.50000 46-35-56.7 N FL NE 081-51-18.3 W 0002981864 FORT MYERS BROADCASTING COMPAFort Myers 04/05/2007 00948.00000 26-39-04.2 N CO NE 105-05-57.0 W 0002982633 EDUCATIONAL MEDIA FOUNDATION Lakewood 04/05/2007 00951.00000 39-43-36.0 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD KNKI478 096-48-14.0 W 0002984033 Bell Industries, Inc. Dallas 04/06/2007 00931.93750 32-46-48.0 N TX MD KNKI478 096-48-06.0 W 0002984033 Bell Industries, Inc. DALLAS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272393A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272393A1.txt
  • MD WPUA917 089-41-09.1 W 0002990387 Madison Cellular Telephone Company MT. HOREB 04/11/2007 10617.50000 43-00-11.6 N WY MD WQBH224 105-26-36.6 W 0002990432 Union Telephone Company Laramie 04/11/2007 10915.00000 41-13-58.6 N WY MD WQGL237 105-42-01.3 W 0002990451 Union Telelphone Company Laramie 04/11/2007 11132.50000 41-20-56.6 N WY MD WQGL237 105-42-01.3 W 0002990451 Union Telelphone Company Laramie 04/11/2007 11622.50000 41-20-56.6 N VA MD WQGP366 077-23-04.2 W 0002990473 FiberTower Network Services Corp. Prince William 04/11/2007 10755.00000 38-42-37.4 N VA MD WQGP366 077-23-04.2 W 0002990473 FiberTower Network Services Corp. Prince William 04/11/2007 10795.00000 38-42-37.4 N AZ MD WMS297 111-27-17.1 W 0002990874 Verizon Wireless (VAW) LLC PAGE 04/11/2007 06034.15000 36-54-37.3 N AZ MD WPTQ908 111-36-34.0 W 0002990884 Verizon Wireless (VAW) LLC Flagstaff 04/11/2007 06256.54000 35-14-29.5 N AZ MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272545A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272545A2.txt
  • 0.8 0.020.919.6 58.7 $164,671 0.6 0.023.119.8 56.5 $57,897 98.4 0.0 0.0 0.0 1.6 35,632,116 1.6 0.012.232.8 53.4 Malta $1,010,356 6.0 0.5 9.621.9 62.0 $93,865 0.0 0.0 0.017.4 82.6 $430 0.0 0.0 0.0 0.2 99.8 8,175,730 4.4 0.2 6.232.5 56.6 Netherlands $46,126,097 1.4 0.026.219.7 52.7 $9,378,634 1.5 0.010.842.3 45.4 $10,375,680 97.3 0.0 0.0 0.0 2.7 760,730,297 1.3 0.015.331.6 51.8 Norway $16,101,944 4.2 0.014.917.7 63.2 $1,510,863 16.5 0.037.712.0 33.8 $6,588,608100.0 0.0 0.0 0.0 0.0 179,963,091 4.6 0.023.721.3 50.4 Portugal $18,433,780 5.5 0.011.021.2 62.3 $1,214,563 0.8 0.0 4.028.9 66.3 $485,943 97.7 0.0 0.0 0.0 2.3 229,257,919 8.1 0.0 9.922.2 59.8 Spain $62,612,568 6.0 0.033.814.6 45.6 $3,784,926 24.5 0.013.026.8 35.7 $26,588,892 98.1 0.0 0.0 0.1 1.8 570,933,062 10.6 0.020.518.4 50.5 Sweden $25,481,409 2.4 0.113.430.0 54.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272549A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272549A1.txt
  • Frequency (MHz) Applicant Name Latitude City VA NE 077-29-12.0 W 0002995964 FiberTower Network Services Corp. Ashburn 04/17/2007 11225.00000 39-02-38.0 N VA NE 077-29-12.0 W 0002995964 FiberTower Network Services Corp. Ashburn 04/17/2007 11325.00000 39-02-38.0 N VA NE 077-31-59.0 W 0002995967 FiberTower Network Services Corp. LEESBURG 04/17/2007 11485.00000 39-12-56.0 N NH NE 071-16-03.5 W 0002996157 FiberTower Network Services Corp. CANDIA 04/17/2007 11325.00000 43-02-04.2 N MA NE 070-55-16.0 W 0002996159 FiberTower Network Services Corp. HINGHAM 04/17/2007 11245.00000 42-15-05.0 N MA NE 070-55-16.0 W 0002996159 FiberTower Network Services Corp. HINGHAM 04/17/2007 11285.00000 42-15-05.0 N CA NE 116-09-04.3 W 0002996402 Sprint Telephony PCS L.P. Ludlow 04/17/2007 10578.12500 34-42-36.2 N OR NE 123-21-58.0 W 0002997434 T-MOBILE LICENSE LLC HUGO 04/18/2007 17975.00000 42-35-58.0 N OR NE 123-55-48.9 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272772A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272772A1.txt
  • City AL MD WMM928 086-13-35.5 W 0003003867 ALLTEL COMMUNICATIONS, INC. LUVERNE 04/24/2007 06034.15000 31-39-58.8 N AL MD WMM928 086-13-35.5 W 0003003867 ALLTEL COMMUNICATIONS, INC. LUVERNE 04/24/2007 06093.45000 31-39-58.8 N AL MD WMM928 086-13-35.5 W 0003003867 ALLTEL COMMUNICATIONS, INC. LUVERNE 04/24/2007 06123.10000 31-39-58.8 N AL MD WMM928 086-13-35.5 W 0003003867 ALLTEL COMMUNICATIONS, INC. LUVERNE 04/24/2007 06152.75000 31-39-58.8 N AL MD WPOR242 086-39-04.2 W 0003003869 ALLTEL Communications, Inc. GREENVILLE 04/24/2007 06034.15000 31-49-09.7 N AL MD WPOR242 086-39-04.2 W 0003003869 ALLTEL Communications, Inc. GREENVILLE 04/24/2007 06063.80000 31-49-09.7 N AL MD WPOR242 086-39-04.2 W 0003003869 ALLTEL Communications, Inc. GREENVILLE 04/24/2007 06197.24000 31-49-09.7 N AL MD WPOR242 086-39-04.2 W 0003003869 ALLTEL Communications, Inc. GREENVILLE 04/24/2007 06375.14000 31-49-09.7 N AL MD WPVA651 086-33-58.0 W 0003003870 ALLTEL COMMUNICATIONS,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273044A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273044A1.txt
  • Name Latitude City FL NE 081-03-45.2 W 0003023142 Ormond Beach, City of Ormond Beach 05/09/2007 00952.23125 29-16-46.9 N AZ NE 112-20-28.8 W 0003023904 Dysart Unified School District El Mirage 05/09/2007 19555.00000 33-35-28.5 N AZ NE 112-20-28.8 W 0003023904 Dysart Unified School District El Mirage 05/09/2007 19645.00000 33-35-28.5 N AZ NE 112-26-36.0 W 0003023962 Dysart Unified School District Surprise 05/09/2007 17875.00000 33-38-04.2 N AZ NE 112-26-36.0 W 0003023962 Dysart Unified School District Surprise 05/09/2007 18085.00000 33-38-04.2 N AZ NE 112-23-14.4 W 0003024466 Dysart Unified School District Surprise 05/09/2007 17995.00000 33-37-36.9 N AZ NE 112-23-14.4 W 0003024466 Dysart Unified School District Surprise 05/09/2007 19435.00000 33-37-36.9 N AZ NE 112-19-38.4 W 0003024503 Surprise, City of Surprise 05/09/2007 17755.00000 33-38-14.9 N AZ NE 112-22-41.9 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273956A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273956A1.txt
  • Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC NE 080-45-58.3 W 0003059581 FiberTower Network Service Corp. Charlotte 06/05/2007 10815.00000 35-06-46.4 N NC NE 080-32-41.4 W 0003059584 FiberTower Network Service Corp. CONCORD 06/05/2007 10755.00000 35-22-11.9 N NC NE 080-32-41.4 W 0003059584 FiberTower Network Service Corp. CONCORD 06/05/2007 10795.00000 35-22-11.9 N NC NE 080-44-04.2 W 0003059586 FiberTower Network Service Corp. KANNAPOLIS 06/05/2007 10815.00000 35-27-03.3 N NC NE 080-44-04.2 W 0003059586 FiberTower Network Service Corp. KANNAPOLIS 06/05/2007 10875.00000 35-27-03.3 N NC NE 080-47-03.9 W 0003059589 FiberTower Network Service Corp. CHARLOTTE 06/05/2007 10915.00000 35-07-11.7 N NC NE 080-47-03.9 W 0003059589 FiberTower Network Service Corp. CHARLOTTE 06/05/2007 10955.00000 35-07-11.7 N NC NE 080-39-41.8 W 0003059593 FiberTower Network
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274025A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274025A1.txt
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. Through 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by incumbent LECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274368A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274368A1.txt
  • W 0003071907 EASTERBROOKE CELLULAR CORPORAFLATWOODS 06/14/2007 10755.00000 38-43-42.4 N NH MD WMN299 071-16-02.1 W 0003072439 New Cingular Wireless PCS, LLC CANDIA 06/15/2007 02124.80000 43-03-11.8 N NH MD WMN299 071-16-02.1 W 0003072439 New Cingular Wireless PCS, LLC CANDIA 06/15/2007 10556.25000 43-03-11.8 N NH MD WMN299 071-16-02.1 W 0003072439 New Cingular Wireless PCS, LLC CANDIA 06/15/2007 11622.50000 43-03-11.8 N NH MD WPJF602 071-16-04.2 W 0003072442 New Cingular Wireless PCS, LLC CHESTER 06/15/2007 11132.50000 42-57-05.3 N NC MD WMQ653 080-11-58.7 W 0003073426 ALLTEL COMMUNICATIONS OF NORTHMIDWAY 06/15/2007 06226.89000 35-57-16.6 N NC MD WMQ654 080-06-02.4 W 0003073428 ALLTEL COMMUNICATIONS OF NORTHTHOMASVILLE 06/15/2007 05974.85000 35-54-06.9 N NC MD WMQ654 080-06-02.4 W 0003073428 ALLTEL COMMUNICATIONS OF NORTHTHOMASVILLE 06/15/2007 06004.50000 35-54-06.9 N NC MD WMQ654 080-06-02.4 W 0003073428
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274572A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274572A1.txt
  • Page 18 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH NE 080-44-06.1 W 0003076831 FiberTower Network Service Corp. AUSTINTOWN TWP 06/19/2007 11245.00000 41-05-49.4 N OH NE 080-44-06.1 W 0003076831 FiberTower Network Service Corp. AUSTINTOWN TWP 06/19/2007 23125.00000 41-05-49.4 N OH NE 080-40-04.2 W 0003076832 FiberTower Network Service Corp. GIRARD 06/19/2007 11285.00000 41-10-48.2 N OH NE 080-40-04.2 W 0003076832 FiberTower Network Service Corp. GIRARD 06/19/2007 11325.00000 41-10-48.2 N OH NE 080-40-04.2 W 0003076832 FiberTower Network Service Corp. GIRARD 06/19/2007 11365.00000 41-10-48.2 N OH NE 080-51-28.7 W 0003076833 FiberTower Network Service Corp. LORDSTOWN 06/19/2007 17800.00000 41-09-25.8 N OH NE 080-45-01.9 W 0003076834 FiberTower Network
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275038A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275038A1.txt
  • 34-03-26.0 N CA MD WLM638 117-03-09.1 W 0003094994 Verizon Wireless (VAW) LLC SAN DIEGO 07/02/2007 11245.00000 32-42-17.2 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WLT476 117-01-23.1 W 0003094999 Verizon Wireless (VAW) LLC CHULA VISTA 07/02/2007 10755.00000 32-37-04.2 N CA MD WLT468 118-21-16.3 W 0003095052 LOS ANGELES SMSA LIMITED PARTNETORRANCE 07/02/2007 10572.50000 33-50-05.1 N CA MD WPJB369 118-22-07.2 W 0003095062 LOS ANGELES SMSA LIMITED PARTNEREDONDO BEACH 07/02/2007 10637.50000 33-52-25.0 N LA MD WQFK423 089-58-25.6 W 0003095095 Trillion Partners, Inc. Belle Chasse 07/02/2007 19560.00000 29-53-31.6 N LA MD WQFK423 089-58-25.6 W 0003095095 Trillion Partners, Inc. Belle Chasse 07/02/2007 23025.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275482A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275482A1.txt
  • Corp Lynn 07/16/2007 18080.00000 42-27-46.9 N NE NE 098-51-30.3 W 0003110891 USCOC NEBRASKA/KANSAS, LLC Minden 07/16/2007 06745.62500 40-28-55.0 N NE NE 098-51-30.3 W 0003110891 USCOC NEBRASKA/KANSAS, LLC Minden 07/16/2007 06785.00000 40-28-55.0 N NE NE 098-42-14.3 W 0003110906 USCOC NEBRASKA/KANSAS, LLC Kenesaw 07/16/2007 06605.00000 40-38-22.1 N NE NE 098-42-14.3 W 0003110906 USCOC NEBRASKA/KANSAS, LLC Kenesaw 07/16/2007 06625.00000 40-38-22.1 N NE NE 098-31-04.2 W 0003110912 USCOC NEBRASKA/KANSAS, LLC Red Cloud 07/16/2007 06545.62500 40-10-29.1 N NE NE 098-31-04.2 W 0003110912 USCOC NEBRASKA/KANSAS, LLC Red Cloud 07/16/2007 06585.62500 40-10-29.1 N NE NE 098-04-15.1 W 0003110972 USCOC NEBRASKA/KANSAS, LLC Nelson 07/16/2007 06715.62500 40-10-45.1 N NE NE 098-51-15.9 W 0003110987 USCOC NEBRASKA/KANSAS, LLC Gibbon 07/16/2007 06545.62500 40-42-01.6 N ID NE 111-46-46.8 W 0003112702 Microserv Computer Technologies, Inc.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275483A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275483A1.txt
  • Latitude City MO NE 094-30-41.3 W 0003115988 Mid America Regional Council EmergencyKansas City 07/19/2007 17900.00000 38-55-12.4 N MO NE 094-30-41.3 W 0003115988 Mid America Regional Council EmergencyKansas City 07/19/2007 17980.00000 38-55-12.4 N MO NE 094-30-41.3 W 0003115988 Mid America Regional Council EmergencyKansas City 07/19/2007 17980.00000 38-55-12.4 N KS NE 094-39-24.0 W 0003115998 Mid America Regional Council EmergencyOverland Park 07/19/2007 19460.00000 38-55-04.2 N KS NE 094-39-24.0 W 0003115998 Mid America Regional Council EmergencyOverland Park 07/19/2007 19460.00000 38-55-04.2 N PA NE 076-53-00.6 W 0003116042 DAUPHIN COUNTY EMERGENCY MANAHARRISBURG 07/19/2007 06765.00000 40-15-37.7 N NY NE 077-49-35.0 W 0003116450 LIVINGSTON, COUNTY OF Mt. Morris 07/19/2007 18085.00000 42-43-51.7 N NY NE 077-53-11.0 W 0003116451 LIVINGSTON, COUNTY OF Mt. Morris 07/19/2007 19645.00000 42-44-00.0 N PA NE 076-44-04.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275804A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275804A1.txt
  • 38-56-24.3 N DC MD KB55252 P 077-04-52.9 W 0003129085 NBC TELEMUNDO LICENSE CO. WASHINGTON 08/02/2007 02008.00000 - 02110.00000 38-56-24.3 N DC MD KB55252 P 077-04-52.9 W 0003129085 NBC TELEMUNDO LICENSE CO. WASHINGTON 08/02/2007 02008.00000 - 02110.00000 38-56-24.3 N DC MD KB55252 P 077-04-52.9 W 0003129085 NBC TELEMUNDO LICENSE CO. WASHINGTON 08/02/2007 02025.50000 - 02109.50000 38-56-24.3 N CA MD KB55953 P 118-20-04.2 W 0003129096 NBC TELEMUNDO LICENSE CO. LOS ANGELES 08/02/2007 01990.00000 - 02008.00000 34-09-19.0 N CA MD KB55953 P 118-20-04.2 W 0003129096 NBC TELEMUNDO LICENSE CO. LOS ANGELES 08/02/2007 01990.00000 - 02008.00000 34-09-19.0 N CA MD KB55953 P 118-20-04.2 W 0003129096 NBC TELEMUNDO LICENSE CO. LOS ANGELES 08/02/2007 01990.00000 - 02008.00000 34-09-19.0 N CA MD KB55953 P 118-20-04.2 W 0003129096 NBC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276117A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276117A1.txt
  • N IN AM 086-14-20.0 W 0003136412 Cyberlink International Indianapolis 08/15/2007 11485.00000 39-54-38.4 N IN AM 086-16-23.8 W 0003136428 Cyberlink International Indianapolis 08/15/2007 11605.00000 39-46-12.0 N IN AM 086-31-27.2 W 0003137636 Cyberlink International BURROWS 08/15/2007 06034.15000 40-40-10.4 N IN AM 086-31-27.2 W 0003137636 Cyberlink International BURROWS 08/15/2007 11405.00000 40-40-10.4 N IN AM 086-29-57.0 W 0003137673 Cyberlink International Royal Center 08/15/2007 10915.00000 40-52-04.2 N IN AM 086-29-57.0 W 0003137673 Cyberlink International Royal Center 08/15/2007 11115.00000 40-52-04.2 N IN AM 086-30-55.0 W 0003137701 Cyberlink International WINAMAC 08/15/2007 11365.00000 41-02-21.0 N IN AM 086-30-55.0 W 0003137701 Cyberlink International WINAMAC 08/15/2007 11605.00000 41-02-21.0 N IN AM 086-28-51.0 W 0003137734 Cyberlink International CULVER 08/15/2007 06152.75000 41-13-48.0 N IN AM 086-28-51.0 W 0003137734 Cyberlink International CULVER 08/15/2007 10875.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276276A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276276A1.txt
  • N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC NE 080-22-28.0 W 0003145596 Conterra Ultra Broadband, LLC CLEMMONS 08/21/2007 10945.00000 36-02-25.0 N NC NE 080-19-01.0 W 0003145598 Conterra Ultra Broadband, LLC WINSTON SALEM 08/21/2007 10775.00000 36-07-08.2 N SC NE 082-16-04.2 W 0003145607 Conterra Ultra Broadband, LLC Taylors 08/21/2007 11205.00000 34-56-49.4 N SC NE 082-04-56.9 W 0003145610 Conterra Ultra Broadband, LLC Startex 08/21/2007 10705.00000 34-56-01.5 N AZ NE 112-52-43.0 W 0003145629 Commnet Four Corners, LLC AJO 08/21/2007 06141.01400 32-21-59.0 N MN NE 093-02-30.0 W 0003145847 Telecom Transport Management, Inc. INVER GROVE HEI 08/21/2007 19310.00000 44-49-39.0 N MN NE 093-02-30.0 W 0003145847
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276392A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276392A1.txt
  • OPERATINMAUSTON 08/28/2007 06785.00000 43-46-33.0 N WI MD WPNB388 090-04-28.0 W 0003155876 UNITED STATES CELLULAR OPERATINMAUSTON 08/28/2007 10627.50000 43-46-33.0 N WI MD WPNG855 089-51-30.0 W 0003155934 UNITED STATES CELLULAR OPERATINFRIENDSHIP 08/28/2007 06197.24000 44-00-41.0 N WI MD WPNG855 089-51-30.0 W 0003155934 UNITED STATES CELLULAR OPERATINFRIENDSHIP 08/28/2007 06256.54000 44-00-41.0 N UT MD WQHG410 110-42-01.0 W 0003156008 Beehive Telephone Company, Inc. Ticaboo 08/28/2007 06256.54000 37-41-04.2 N UT MD WQHH811 110-47-49.0 W 0003156011 Beehive Telephone Company, Inc. Boulder 08/28/2007 06004.50000 37-57-02.3 N ID MD WQBB886 116-10-28.0 W 0003156066 Idaho RSA No. 1 Limited Partnership Kellogg 08/28/2007 18005.00000 47-32-44.7 N AZ MD WQCE627 113-06-32.0 W 0003156517 CNG COMMUNICATIONS, INC. Tonopah 08/28/2007 11623.12500 33-31-55.0 N ID MD WMR209 116-08-39.5 W 0003156527 Idaho RSA No. 1 Limited Partnership Kellogg
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276695A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276695A1.txt
  • 097-49-37.1 W 0003169250 FiberTower Network Services Corp. AUSTIN 09/11/2007 19360.00000 30-17-16.5 N TX MD WQAW491 097-49-37.1 W 0003169250 FiberTower Network Services Corp. AUSTIN 09/11/2007 19405.00000 30-17-16.5 N TX MD WQAW491 097-49-37.1 W 0003169250 FiberTower Network Services Corp. AUSTIN 09/11/2007 19440.00000 30-17-16.5 N TX MD WQAW491 097-49-37.1 W 0003169250 FiberTower Network Services Corp. AUSTIN 09/11/2007 19495.00000 30-17-16.5 N IL MD WQFF994 087-39-04.2 W 0003169322 FiberTower Network Services Corp. CHICAGO, 09/11/2007 11285.00000 41-49-00.1 N IL MD WQFF994 087-39-04.2 W 0003169322 FiberTower Network Services Corp. CHICAGO, 09/11/2007 17980.00000 41-49-00.1 N IL MD WQFF994 087-39-04.2 W 0003169322 FiberTower Network Services Corp. CHICAGO, 09/11/2007 23175.00000 41-49-00.1 N IL MD WQFF979 087-42-17.0 W 0003169331 FiberTower Network Services Corp. CHICAGO 09/11/2007 19680.00000 41-47-10.0 N IL MD WQFF979 087-42-17.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277038A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277038A1.txt
  • 09/27/2007 00928.73125 32-46-53.9 N NM MD WNTN637 103-30-49.4 W 0003183701 CHEVRON USA INC LOVINGTON 09/27/2007 00952.73125 32-46-53.9 N KS MD WPOQ433 097-15-17.5 W 0003183845 U S D 259 WICHITA 09/27/2007 17800.00000 37-40-27.8 N Page 32 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD WPOQ423 097-26-04.2 W 0003183848 U S D 259 WICHITA 09/27/2007 17880.00000 37-40-36.7 N CO MD KAP43 105-14-58.9 W 0003184067 Xcel Energy Services Inc. GOLDEN 09/27/2007 06545.00000 39-43-54.9 N CO MD WGX948 105-12-23.9 W 0003184072 Xcel Energy Services Inc. GOLDEN 09/27/2007 06715.00000 39-44-03.9 N TX MD KLG71 094-09-24.6 W 0003184635 ENTERGY SERVICES, INC. BEAUMONT 09/28/2007 06675.00000 30-09-21.7 N TX MD KLG71 094-09-24.6 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277386A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277386A1.txt
  • COLUMBUS 10/10/2007 00855.83750 39-57-34.2 N OH MD KNEP572 083-06-43.7 W 0003195494 NEXTEL LICENSE HOLDINGS 4, INC. COLUMBUS 10/10/2007 00855.83750 39-57-41.2 N Page 25 GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD KNEP572 082-53-53.6 W 0003195494 NEXTEL LICENSE HOLDINGS 4, INC. COLUMBUS 10/10/2007 00855.83750 40-03-04.2 N OH MD KNEP572 083-10-35.7 W 0003195494 NEXTEL LICENSE HOLDINGS 4, INC. DUBLIN 10/10/2007 00855.83750 40-06-19.2 N OH MD KNEP572 082-55-42.6 W 0003195494 NEXTEL LICENSE HOLDINGS 4, INC. WESTERVILLE 10/10/2007 00855.83750 40-04-56.2 N OH MD KNEP573 084-11-44.8 W 0003195495 NEXTEL LICENSE HOLDINGS 4, INC. DAYTON 10/10/2007 00855.83750 39-45-35.2 N OH MD KNEP573 084-05-10.9 W 0003195495 NEXTEL LICENSE HOLDINGS 4, INC.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277784A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277784A1.txt
  • 17.1 16.8 16.3 14.1 11.9 8.2 5.7 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 14.0 14.9 14.9 15.1 15.0 14.8 11.3 8.9 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 10.6 11.2 11.6 12.2 12.6 13.5 12.9 11.4 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 7.7 7.8 8.4 8.9 9.7 10.3 12.2 12.5 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 5.3 5.8 6.1 6.3 6.8 7.8 10.4 11.7 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 4.0 4.2 4.4 4.6 5.3 5.7 8.7 10.0 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 3.1 3.3 3.6 3.6 4.0 4.6 7.1 8.3 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 2.5 2.6 2.8 3.1 3.8 4.0 5.8 6.7 Ten or
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277959A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277959A1.txt
  • OF CHWENATCHEE 10/30/2007 06755.00000 47-25-46.4 N WA RM KFG41 120-18-54.2 W 0003215426 PUBLIC UTILITY DISTRICT NO 1 OF CHWENATCHEE 10/30/2007 06805.00000 47-25-46.4 N WA RM KFG41 120-18-54.2 W 0003215426 PUBLIC UTILITY DISTRICT NO 1 OF CHWENATCHEE 10/30/2007 06835.00000 47-25-46.4 N WA RM KFG41 120-18-54.2 W 0003215426 PUBLIC UTILITY DISTRICT NO 1 OF CHWENATCHEE 10/30/2007 06855.00000 47-25-46.4 N WA RM KFG42 120-02-04.2 W 0003215437 PUBLIC UTILITY DISTRICT NO 1 OF CHCHELAN 10/30/2007 02192.80000 47-48-24.4 N WA RM KFG42 120-02-04.2 W 0003215437 PUBLIC UTILITY DISTRICT NO 1 OF CHCHELAN 10/30/2007 06745.00000 47-48-24.4 N WA RM KFG42 120-02-04.2 W 0003215437 PUBLIC UTILITY DISTRICT NO 1 OF CHCHELAN 10/30/2007 06800.00000 47-48-24.4 N WA RM KFG42 120-02-04.2 W 0003215437 PUBLIC UTILITY DISTRICT NO 1 OF CHCHELAN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277961A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277961A1.txt
  • 10/29/2007 06665.00000 35-34-49.0 N CA NE 117-19-59.2 W 0003212375 City of Oceanside Oceanside 10/29/2007 23475.00000 33-12-02.8 N MA NE 073-01-46.4 W 0003212545 BERKSHIRE COUNTY SHERIFF' S OFFISAVOY 10/29/2007 00958.35000 42-36-01.3 N MA NE 073-18-47.4 W 0003212546 BERKSHIRE COUNTY SHERIFF' S OFFIGREAT BARRINGT 10/29/2007 00942.77500 42-10-20.3 N CA NE 117-10-24.8 W 0003212554 Unified Port of San Diego San Diego 10/29/2007 23135.00000 32-43-04.2 N CA NE 117-10-07.4 W 0003212555 Unified Port of San Diego San Diego 10/29/2007 21935.00000 32-42-58.4 N Page 6 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 117-16-36.1 W 0003212566 City of Oceanside OCEANSIDE 10/29/2007 23035.00000 33-14-28.1 N NC NE 080-49-24.0 W 0003215603
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278130A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278130A1.txt
  • DISTRICTCHOWCHILLA 11/05/2007 00956.44375 37-06-55.0 N ID NE P 114-22-01.2 W 0003221255 CITY OF KETCHUM KETCHUM 11/05/2007 00956.36875 43-39-51.8 N ID NE P 111-47-27.6 W 0003221260 FAIRVIEW WATER DISTRICT PRESTON 11/05/2007 00956.26875 42-11-26.5 N AL NE P 085-10-52.3 W 0003221265 LEE CHAMBERS UTILITIES DISTRICT VALLEY 11/05/2007 00956.34375 32-48-37.8 N ID NE P 112-07-33.6 W 0003221269 CITY OF ROBERTS ROBERTS 11/05/2007 00956.39375 43-44-04.2 N Page 31 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE P 121-36-30.0 W 0003221285 CITY OF BLACK DIAMOND MAYWOOD 11/05/2007 00956.38125 47-17-17.0 N ID NE P 112-21-39.6 W 0003221288 CITY OF BLACKFOOT BLACKFOOT 11/05/2007 00956.41875 43-12-02.9 N MO NE P 090-23-40.2 W 0003221293
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278297A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278297A1.txt
  • 11/16/2007 06315.84000 38-24-13.4 N MS NE 090-52-55.0 W 0003227853 City of Vicksburg, Mississippi Vicksburg 11/13/2007 17820.00000 32-20-43.0 N MS NE 090-53-24.4 W 0003227860 City of Vicksburg Mississippi Vicksburg 11/13/2007 19380.00000 32-19-12.8 N WI NE 089-32-54.0 W 0003229730 COLUMBIA, COUNTY OF PORTAGE 11/13/2007 10592.50000 43-29-45.0 N WI NE 089-27-02.0 W 0003229732 COLUMBIA, COUNTY OF PORTAGE 11/13/2007 10657.50000 43-32-44.0 N WA NE 120-23-04.2 W 0003229909 WASHINGTON, STATE OF YAKIMA 11/13/2007 06256.54000 46-38-26.8 N WA NE 120-23-04.2 W 0003229909 WASHINGTON, STATE OF YAKIMA 11/13/2007 11445.00000 46-38-26.8 N WA NE 117-04-55.6 W 0003229911 WASHINGTON, STATE OF SPOKANE 11/13/2007 06152.75000 47-34-22.2 N WA NE 117-04-55.6 W 0003229911 WASHINGTON, STATE OF SPOKANE 11/13/2007 10755.00000 47-34-22.2 N Page 3 MW - Microwave Public Safety Pool State Purpose Call
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278832A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278832A1.txt
  • 39-06-53.4 N NY NE 075-03-33.9 W 0003246505 St. Lawrence Seaway RSA Potsdam 12/03/2007 06625.00000 44-38-18.6 N NY NE 075-03-33.9 W 0003246505 St. Lawrence Seaway RSA Potsdam 12/03/2007 10835.00000 44-38-18.6 N Page 8 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY NE 075-48-04.2 W 0003246522 St. Lawrence Seaway RSA Cellular PartneTheresa 12/03/2007 06286.19000 44-12-45.1 N NY NE 075-48-04.2 W 0003246522 St. Lawrence Seaway RSA Cellular PartneTheresa 12/03/2007 11405.00000 44-12-45.1 N NY NE 075-35-26.8 W 0003246523 St. Lawrence Seaway RSA Cellular PartneCarthage 12/03/2007 06034.15000 43-59-51.6 N NY NE 076-07-13.5 W 0003246524 St. Lawrence Seaway RSA Cellular PartneChaumont 12/03/2007 10617.50000 44-03-51.8 N NY NE 075-46-47.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278856A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278856A1.txt
  • Longitude Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. PW - Public Safety Pool, Conventional Public Safety and Homeland Security Bureau 11/03/2007 KAF904 FXO DUNN MEMORIAL HOSPITAL 458.68750000 BEDFORD 38-51-37.2 N IN 86-29-55.0 W 8 1 11/06/2007 WNEC687 FX1 SALISBURY, TOWN OF 153.95000000 SALISBURY 42-50-29.3 N MA 70-49-4.2 W 1 1 11/06/2007 WNEC687 FX1 SALISBURY, TOWN OF 153.95000000 SALISBURY 42-50-45.3 N MA 70-51-45.2 W 2 1 11/06/2007 WNEC687 MO SALISBURY, TOWN OF 153.95000000 -- -- 3 1 11/06/2007 WNEC687 FB2 SALISBURY, TOWN OF 158.95500000 SALISBURY 42-50-42.5 N MA 70-53-38.6 W 4 1 11/07/2007 WPMF280 MO FRANKLIN LAKES, BOROUGH OF 159.09000000 -- -- 3 1 11/07/2007 WPMF280 FB FRANKLIN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279015A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279015A1.txt
  • W 0003256122 UNION PACIFIC RAILROAD PLEASANT HILL 12/11/2007 06845.00000 38-46-58.0 N CA MD WNTR252 115-12-23.9 W 0003256188 Pacific Gas and Electric Company DANBY 12/11/2007 06830.62500 34-35-20.0 N CA MD WNTR251 114-29-31.8 W 0003256189 Pacific Gas and Electric Company Needles 12/11/2007 06670.62500 34-42-51.0 N NM MD WPOP406 107-53-48.2 W 0003256565 Williams Energy Services AZTEC 12/12/2007 19375.00000 36-48-40.0 N NM MD WPOP405 107-57-04.2 W 0003256567 Williams Energy Services BLOOMFIELD 12/12/2007 17815.00000 36-43-47.0 N CA MD WQHV893 118-27-34.9 W 0003258311 Nextweb Inc Los Angeles 12/13/2007 17930.00000 34-03-03.0 N CA MD WQHV893 118-27-34.9 W 0003258311 Nextweb Inc Los Angeles 12/13/2007 21870.00000 34-03-03.0 N IL MD WQGY935 087-38-32.6 W 0003258318 Sparkplug Chicago Inc Chicago 12/13/2007 21975.00000 41-53-27.0 N IL MD WQGY935 087-38-32.6 W 0003258318 Sparkplug Chicago
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279160A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279160A1.txt
  • NY MD KA20003 P 073-59-09.0 W 0003265607 NBC TELEMUNDO LICENSE CO. NEW YORK 12/21/2007 02025.00000 - 02025.50000 40-44-54.0 N NY MD KA20003 P 073-59-09.0 W 0003265607 NBC TELEMUNDO LICENSE CO. NEW YORK 12/21/2007 02025.50000 - 02109.50000 40-44-54.0 N NY MD KA20003 P 073-59-09.0 W 0003265607 NBC TELEMUNDO LICENSE CO. NEW YORK 12/21/2007 02109.50000 - 02110.00000 40-44-54.0 N MD KA88725 O 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO. LOS ANGELES 12/21/2007 01990.00000 - 02008.00000 34-09-19.0 N MD KA88725 O 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO. LOS ANGELES 12/21/2007 01990.00000 - 02008.00000 34-09-19.0 N MD KA88725 O 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO. LOS ANGELES 12/21/2007 02008.00000 - 02110.00000 34-09-19.0 N MD KA88725 O 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A1.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 5 Index of Tables and Charts Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A11.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A11.txt
  • 4.1 12.5 94.9 3.6 22.9 3.6 5.9 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 96.7 99.5 93.7 99.2 96.7 97.2 95.9 95.7 Residence 97.1 99.6 93.7 99.2 97.0 97.4 96.3 95.8 Business 95.3 98.8 94.1 98.9 94.5 95.9 91.5 94.8 Average Installation Interval (days) 1.0 2.4 4.9 4.8 1.9 1.4 2.6 2.8 Residence 0.9 2.0 4.2 4.1 1.8 1.4 2.5 2.8 Business 1.5 4.9 6.7 7.8 2.5 1.4 3.1 3.5 Average Out of Service Repair Interval (hours) 9.6 22.0 17.4 16.8 18.5 12.1 14.0 21.0 Residence 9.5 21.8 17.7 17.0 18.7 12.2 14.6 21.9 Business 9.8 17.3 15.6 15.4 16.6 10.6 11.7 18.6 Initial Trouble Reports per Thousand Lines 213.3 119.5 270.3 243.2 220.1 161.1 143.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A2.txt
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 5 Index of Tables and Charts Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A3.txt
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. Through 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. Significant amounts of enhanced services, billing and collection,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A6.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A6.txt
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for Funding Years 2004, 2005 and 2006. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A8.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A8.txt
  • 95.5 95.2 -0.3 Delaware 94.3 93.5 -0.8 District of Columbia 94.9 91.2 -3.7 # Florida 88.7 92.7 4.0 * Georgia 86.2 90.5 4.3 * Hawaii 93.5 95.5 2.0 * Idaho 90.7 95.5 4.8 * Illinois 94.2 90.8 -3.4 # Indiana 91.6 89.3 -2.3 # Iowa 96.2 96.1 -0.1 Kansas 94.3 94.3 0.0 Kentucky 88.1 91.3 3.1 * Louisiana 89.7 93.9 4.2 * Maine 93.4 96.3 2.9 * Maryland 95.7 95.4 -0.3 Massachusetts 95.9 95.3 -0.6 Michigan 92.8 94.2 1.3 * Minnesota 95.8 97.6 1.8 * Mississippi 82.4 90.5 8.1 * Missouri 91.5 94.9 3.4 * Montana 91.0 93.3 2.3 * Nebraska 95.7 93.5 -2.2 # Nevada 90.4 93.0 2.6 * New Hampshire 94.3 96.4 2.1 * New Jersey 94.8 94.9 0.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A9.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A9.txt
  • 2002 2003 2004 2005 2006 Percen t Ch ang e fro m P rior Y ear CPI - All Items CPI - Telephone Service 7 - 7 1978 1.4% 3.1% -0.7% 0.0% 1.3% 0.1% 1979 1.7 1.6 -0.8 -0.9 0.1 -0.7 1980 7.0 7.1 3.4 5.5 -0.6 2.3 1981 12.6 15.6 14.6 15.9 6.2 8.0 1982 10.8 9.0 2.7 3.9 4.2 1.7 1983 3.1 0.2 1.4 0.0 7.4 3.9 1984 17.2 10.4 -4.3 -5.1 3.6 3.8 1985 8.9 12.4 -3.7 -3.0 0.6 2.1 1986 7.1 8.9 -9.4 -10.0 0.3 -3.5 1987 3.3 2.6 -12.4 -11.8 -3.0 -3.0 1988 4.5 4.6 -4.2 -2.1 -4.2 -3.8 1989 0.6 1.9 -1.3 -1.7 -2.6 0.5 1990 1.0 1.5 -3.7 -0.1 -2.2 -2.2 1991 5.1 2.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279231A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279231A1.txt
  • revised. 2004 State 2003 2005 2006 Zero 44.0%38.0%31.3% 25.1% 21.9% 17.4% 18.4% 17.7% 17.7% One 16.8 16.8 19.3 17.3 15.3 10.5 11.4 11.3 11.1 Two 10.4 10.0 10.4 10.4 11.6 7.6 7.6 7.8 8.2 Three 7.2 7.7 6.7 7.0 7.6 6.0 6.2 6.2 6.7 Four 5.5 6.1 6.3 5.3 5.7 4.8 4.7 5.0 5.2 Five 4.0 4.5 5.2 4.8 5.2 4.2 4.1 4.2 4.4 Six 3.0 3.8 4.4 4.7 4.4 3.4 3.6 3.5 3.8 Seven 2.3 2.9 3.5 4.1 4.2 3.1 3.3 3.2 3.2 Eight 1.7 2.2 2.9 3.7 3.7 3.1 2.9 2.9 3.0 Nine 1.4 2.1 2.6 3.2 3.2 2.8 2.7 2.8 2.7 Ten or More 3.7 5.9 7.3 14.4 17.3 36.9 35.0 35.3 34.0 Zero 11.8% 8.8% 5.8% 3.8%
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279647A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279647A1.txt
  • LLC Avoca 01/16/2008 10795.00000 32-51-55.6 N PR NE 065-50-19.8 W 0003290603 NEPTUNO MEDIA HUMACAO 01/16/2008 10835.00000 18-07-26.8 N PR NE 066-19-09.3 W 0003291468 Puerto Rico Telephone Company, Inc. Salinas 01/16/2008 19425.00000 17-59-25.6 N PR NE 065-47-28.0 W 0003291470 NEPTUNO MEDIA RIO GRANDE 01/16/2008 11485.00000 18-21-39.8 N PR NE 066-06-30.2 W 0003291473 NEPTUNO MEDIA Guaynabo 01/16/2008 10835.00000 18-22-08.4 N AZ NE 112-16-04.2 W 0003292742 T-MOBILE LICENSE LLC GLENDALE 01/17/2008 19330.00000 33-31-47.2 N AZ NE 112-16-17.9 W 0003292743 T-MOBILE LICENSE LLC Peoria 01/17/2008 17770.00000 33-32-50.7 N Page 14 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 118-11-22.5 W 0003292744 T-MOBILE LICENSE LLC LONG
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279648A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279648A1.txt
  • 0003294701 PACIFIC AND SOUTHERN COMPANY, IN 01/18/2008 02467.00000 - 02483.50000 MD KC23812 O 0003294701 PACIFIC AND SOUTHERN COMPANY, IN 01/18/2008 02467.00000 - 02483.50000 TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ME MD KCE20 070-17-05.1 W 0003286310 WGME LICENSEE, LLC PORTLAND 01/14/2008 06900.00000 - 06925.00000 43-42-04.2 N AL MD WMU870 085-23-32.7 W 0003289707 GRAY TELEVISION LICENSEE, INC. Dothan 01/16/2008 02008.00000 - 02025.00000 31-13-34.6 N AL MD WMU870 085-23-32.7 W 0003289707 GRAY TELEVISION LICENSEE, INC. Dothan 01/16/2008 02037.50000 - 02049.50000 31-13-34.6 N YX - SMR, 806-821/851-866 MHz, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPBQ391
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279649A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279649A1.txt
  • PA MD WPNB760 075-32-49.6 W 0003294707 LACKAWANNA, COUNTY OF MOSCOW 01/18/2008 06595.62500 41-15-58.2 N PA MD WPNB760 075-32-49.6 W 0003294707 LACKAWANNA, COUNTY OF MOSCOW 01/18/2008 06610.62500 41-15-58.2 N PA MD WPNB765 075-44-47.6 W 0003294714 LACKAWANNA, COUNTY OF SCRANTON 01/18/2008 06770.62500 41-25-39.2 N CA MD WNTF562 118-50-10.3 W 0003294756 Ventura, County of THOUSAND OAKS 01/18/2008 22035.00000 34-14-53.0 N CA MD WPJD520 117-32-04.2 W 0003295198 CALIFORNIA, STATE OF TRABUCO CANYON 01/18/2008 06765.00000 33-42-41.1 N Page 7 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPJD520 117-32-04.2 W 0003295198 CALIFORNIA, STATE OF TRABUCO CANYON 01/18/2008 17760.00000 33-42-41.1 N CA MD KMP20 117-31-59.2 W 0003295200 CALIFORNIA, STATE OF
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279929A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279929A1.txt
  • 11,696 44.4 576 2.2 119 0.5 605 2.3 192 0.7 13,163 50.0 26,351 Texas 45,063 41.6 3,140 2.9 644 0.6 2,513 2.3 2,074 1.9 54,818 50.6 108,252 Utah 5,843 51.4 39 0.3 70 0.6 237 2.1 100 0.9 5,082 44.7 11,372 Vermont 2,162 44.4 9 0.2 53 1.1 56 1.1 41 0.8 2,548 52.3 4,869 Virgin Islands 155 48.3 13 4.2 30 9.3 32 10.0 1 0.5 89 27.8 320 Virginia 16,949 55.0 139 0.5 412 1.3 917 3.0 203 0.7 12,214 39.6 30,834 Washington 13,479 48.9 1,203 4.4 150 0.5 623 2.3 398 1.4 11,696 42.5 27,548 West Virginia 2,527 39.8 30 0.5 95 1.5 147 2.3 67 1.1 3,487 54.9 6,354 Wisconsin 9,648 36.7 323 1.2 283 1.1 377
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279931A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279931A1.txt
  • correction continues beyond the date of publication of this report, as new problems are identified. Reporting companies frequently re-file data, not only for the current reporting period, but also occasionally for previous reporting periods. Hence, users of the quality of service report data may find some inconsistencies with data extracted from the ARMIS database at a later or earlier date. 4.2 Commission Recalculation of Holding Company Aggregate Statistics Commission staff do not typically delete or adjust company-filed data for presentation in the quality of service report, except for recalculating holding company totals and other data aggregates as described in Section 3.1. Recalculated aggregates appear in the tables of the quality of service report. These may not match corresponding company-filed totals and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280030A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280030A1.txt
  • 05974.85000 39-26-37.7 N DE MD WQCP236 075-39-32.9 W 0003304351 STATE OF DELAWARE - DTI WRANGLE HILL 01/28/2008 05945.20000 39-34-42.2 N KY MD WQHC521 083-07-52.0 W 0003304886 KENTUCKY, COMMONWEALTH OF SALYERSVILLE 01/28/2008 06718.75000 37-45-42.0 N AZ MD WCE391 110-33-40.3 W 0003305135 ARIZONA, STATE OF GLOBE 01/28/2008 06635.62500 33-39-37.1 N AZ MD WGY479 110-44-48.3 W 0003305149 ARIZONA, STATE OF GLOBE 01/28/2008 06805.00000 33-24-04.2 N AZ MD KOK44 112-04-00.5 W 0003305214 ARIZONA, STATE OF PHOENIX 01/28/2008 06315.84000 33-19-57.1 N PA MD WNEF310 075-09-04.6 W 0003305798 MONTGOMERY, COUNTY OF Dresher 01/29/2008 06815.62500 40-08-41.4 N PA MD WQCE913 075-25-04.0 W 0003305799 MONTGOMERY COUNTY OF EAGLEVILLE 01/29/2008 02186.40000 40-09-29.0 N PA MD WQCE913 075-25-04.0 W 0003305799 MONTGOMERY COUNTY OF EAGLEVILLE 01/29/2008 02196.00000 40-09-29.0 N PA MD WQCE913
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280031A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280031A1.txt
  • METROPOLITAN AREA NETWORKS, INMcDavid 01/29/2008 05945.20000 30-53-32.1 N Page 11 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 087-21-01.8 W 0003305429 METROPOLITAN AREA NETWORKS, INCantonment 01/29/2008 06197.24000 30-40-42.5 N FL NE 087-19-55.1 W 0003305430 METROPOLITAN AREA NETWORKS, INMcDavid 01/29/2008 06256.54000 30-48-04.1 N FL NE 087-17-04.2 W 0003305431 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 06004.50000 30-33-37.3 N FL NE 087-17-04.2 W 0003305431 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 11245.00000 30-33-37.3 N AL NE 087-28-27.9 W 0003305432 METROPOLITAN AREA NETWORKS, INROBERTSDALE 01/29/2008 11445.00000 30-34-48.3 N FL NE 087-24-23.6 W 0003305433 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 10955.00000 30-32-10.7 N FL NE 086-58-37.9 W 0003305434 METROPOLITAN AREA NETWORKS, INMILTON 01/29/2008 11115.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280033A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280033A1.txt
  • MI MD WLT662 083-56-00.0 W 0003308592 Alltel Telelink, Inc. BAY CITY 01/30/2008 06345.49000 43-32-50.0 N MI MD WLT670 085-47-13.0 W 0003308594 Alltel Telelink, Inc. MATTAWAN 01/30/2008 02174.80000 42-13-54.0 N MI MD WLT670 085-47-13.0 W 0003308594 Alltel Telelink, Inc. MATTAWAN 01/30/2008 02178.00000 42-13-54.0 N MI MD WLT670 085-47-13.0 W 0003308594 Alltel Telelink, Inc. MATTAWAN 01/30/2008 05974.85000 42-13-54.0 N MI MD WLT678 085-40-04.2 W 0003308596 Alltel Telelink, Inc. Otsego 01/30/2008 02115.20000 42-30-25.3 N MI MD WLT678 085-40-04.2 W 0003308596 Alltel Telelink, Inc. Otsego 01/30/2008 02121.60000 42-30-25.3 N MI MD WLT678 085-40-04.2 W 0003308596 Alltel Telelink, Inc. Otsego 01/30/2008 02128.00000 42-30-25.3 N MI MD WLT678 085-40-04.2 W 0003308596 Alltel Telelink, Inc. Otsego 01/30/2008 06226.89000 42-30-25.3 N MS MD WQIC493 090-02-52.0 W 0003308669 Cellular South
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280614A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280614A1.txt
  • Latitude City CO AM 105-10-09.4 W 0003278860 Jefferson, County of Golden 02/22/2008 23070.00000 39-44-04.9 N WA AM WQBH345 122-21-23.0 W 0003289400 Snohomish County Public Transportation SEATTLE 02/27/2008 11668.12500 47-37-48.7 N WA AM 122-14-34.0 W 0003289423 Snohomish County Public Transportaion BEVERETT 02/28/2008 10715.00000 47-55-33.0 N WA AM 122-14-34.0 W 0003289423 Snohomish County Public Transportaion BEVERETT 02/28/2008 19315.00000 47-55-33.0 N AZ AM 112-10-04.2 W 0003321941 State of Arizona, Dept of Public Safety Phoenix 02/25/2008 06197.24000 33-48-02.4 N AZ AM 112-10-04.2 W 0003321941 State of Arizona, Dept of Public Safety Phoenix 02/25/2008 11115.00000 33-48-02.4 N CA AM WNEP885 117-48-39.2 W 0003322225 ORANGE, COUNTY OF, CA NEWPORT BEACH 02/26/2008 06785.00000 33-36-20.1 N WI AM WPOT676 090-22-09.0 W 0003340432 WISCONSIN DOT, STATE PATROL HIGHLAND 02/29/2008 06034.15000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281096A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281096A1.txt
  • Only Broadband, LLC West New York 03/20/2008 10775.00000 40-47-06.3 N FL NE 080-11-34.8 W 0003367515 AirBand Communications, Inc. Miami 03/20/2008 19540.00000 25-46-33.1 N KY NE 084-05-05.1 W 0003367612 Cellco Partnership Lily 03/20/2008 06034.15000 37-02-08.9 N KY NE 084-05-05.1 W 0003367612 Cellco Partnership Lily 03/20/2008 06063.80000 37-02-08.9 N CA NE 117-09-30.8 W 0003367849 airBand Communications, Inc. San Diego, CA 03/20/2008 10835.00000 32-43-04.2 N CA NE 117-09-30.8 W 0003367849 airBand Communications, Inc. San Diego, CA 03/20/2008 11035.00000 32-43-04.2 N CA NE 117-12-29.3 W 0003367850 airBand Communications, Inc. San Diego, CA 03/20/2008 11325.00000 32-52-28.4 N CA NE 117-12-29.3 W 0003367850 airBand Communications, Inc. San Diego, CA 03/20/2008 11605.00000 32-52-28.4 N PR NE 066-25-41.7 W 0003368376 CCPR SERVICES, INC. VEGA BAJA 03/21/2008 11627.50000 18-26-37.8 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281235A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281235A1.txt
  • AR MD WNEX621 093-04-59.6 W 0003370493 ARKANSAS, STATE OF (POLICE DEPT.)MOUNTAIN PINE 03/24/2008 06063.80000 34-34-02.3 N AR MD WNEX621 093-04-59.6 W 0003370493 ARKANSAS, STATE OF (POLICE DEPT.)MOUNTAIN PINE 03/24/2008 06775.00000 34-34-02.3 N AR MD WNEX621 093-04-59.6 W 0003370493 ARKANSAS, STATE OF (POLICE DEPT.)MOUNTAIN PINE 03/24/2008 06795.00000 34-34-02.3 N AZ MD WGY479 110-44-48.3 W 0003370509 ARIZONA, STATE OF GLOBE 03/24/2008 06805.00000 33-24-04.2 N KS MD WPQN503 098-34-19.3 W 0003371166 KANSAS STATE OF, KANSAS DEPARTMPreston 03/25/2008 06805.00000 37-45-48.1 N KS MD WPQN503 098-34-19.3 W 0003371166 KANSAS STATE OF, KANSAS DEPARTMPreston 03/25/2008 06815.00000 37-45-48.1 N KS MD WPQN503 098-34-19.3 W 0003371166 KANSAS STATE OF, KANSAS DEPARTMPreston 03/25/2008 06845.00000 37-45-48.1 N KS MD WPQN502 098-05-42.1 W 0003371167 KANSAS STATE OF, KANSAS DEPARTMPartridge 03/25/2008 06545.00000 37-53-48.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281382A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281382A1.txt
  • Northrop Grumman Information TechnologNew York 04/03/2008 21925.00000 40-47-32.6 N NY NE 073-56-52.8 W 0003383434 Northrop Grumman Information TechnologNew York 04/03/2008 23075.00000 40-47-02.8 N Page 32 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA NE 084-16-18.8 W 0003383460 Clearwire Spectrum Holdings II, LLC Roswell 04/03/2008 10975.00000 33-59-04.2 N GA NE 084-16-18.8 W 0003383460 Clearwire Spectrum Holdings II, LLC Roswell 04/03/2008 11015.00000 33-59-04.2 N GA NE 084-16-18.8 W 0003383460 Clearwire Spectrum Holdings II, LLC Roswell 04/03/2008 11095.00000 33-59-04.2 N GA NE 084-16-18.8 W 0003383460 Clearwire Spectrum Holdings II, LLC Roswell 04/03/2008 11135.00000 33-59-04.2 N GA NE 084-12-32.4 W 0003383461 Clearwire Spectrum Holdings II, LLC Duluth 04/03/2008 11505.00000 33-58-57.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281566A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281566A1.txt
  • 0003392686 UNION PACIFIC RAILROAD DONALDSON 04/10/2008 00932.34375 30-05-45.0 N LA NE 090-59-15.0 W 0003392686 UNION PACIFIC RAILROAD DONALDSON 04/10/2008 00941.34375 30-05-45.0 N LA NE 090-33-32.0 W 0003392720 UNION PACIFIC RAILROAD EDGARD 04/10/2008 00928.05625 30-01-16.0 N LA NE 090-33-32.0 W 0003392720 UNION PACIFIC RAILROAD EDGARD 04/10/2008 00952.05625 30-01-16.0 N CA NE 120-34-56.1 W 0003392737 CLEARWIRE SPECTRUM HOLDINGS II ATWATER 04/10/2008 23075.00000 37-22-04.2 N ID NE 112-48-40.8 W 0003392891 PacifiCorp Neeley 04/10/2008 06093.45000 42-45-24.3 N ID NE 112-01-37.7 W 0003392909 PacifiCorp Swan Lake 04/10/2008 06256.54000 42-20-44.6 N ID NE 112-01-37.7 W 0003392909 PacifiCorp Swan Lake 04/10/2008 06375.14000 42-20-44.6 N Page 50 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281713A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281713A1.txt
  • METROPOLITAN AREA NETWORKS, INPASADENA 04/15/2008 11325.00000 29-37-51.1 N TX NE 095-15-27.7 W 0003397264 METROPOLITAN AREA NETWORKS, INSOUTH HOUSTON 04/15/2008 06034.15000 29-38-55.8 N TX NE 095-26-03.2 W 0003397265 METROPOLITAN AREA NETWORKS, INHouston 04/15/2008 06286.19000 29-34-39.0 N TX NE 095-25-29.0 W 0003397266 METROPOLITAN AREA NETWORKS, INIOWA COLONY 04/15/2008 10835.00000 29-25-43.3 N TX NE 095-12-17.9 W 0003397267 METROPOLITAN AREA NETWORKS, INALVIN 04/15/2008 10755.00000 29-24-04.2 N TX NE 094-56-18.8 W 0003397269 METROPOLITAN AREA NETWORKS, INGALVESTON 04/15/2008 06197.24000 29-12-39.6 N TX NE 095-17-18.3 W 0003397270 METROPOLITAN AREA NETWORKS, INPearland 04/15/2008 10755.00000 29-31-24.2 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 095-35-27.6 W 0003397271 METROPOLITAN AREA NETWORKS, INTomball
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281714A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281714A1.txt
  • CA MD WPQL505 119-36-08.0 W 0003400656 CHEVRON USA INC DERBY ACRES 04/17/2008 10795.00000 35-16-35.0 N NM MD KCP56 108-38-41.2 W 0003401363 EL PASO NATURAL GAS COMPANY GALLUP 04/18/2008 19535.00000 35-32-16.0 N NM MD KKS72 108-41-05.2 W 0003401387 EL PASO NATURAL GAS COMPANY GIBSON 04/18/2008 17975.00000 35-36-17.0 N CA NE P 117-29-10.0 W 0003394388 WEST VALLEY WATER DISTRICT NORCO 04/14/2008 00956.35625 33-56-04.2 N Page 9 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPNM875 0003398794 Trunkline Gas Company, LLC 04/16/2008 NN - 3650-3700 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WQIC997 0003395213 Gila Electronics of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281857A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281857A1.txt
  • AM WQIR801 101-52-41.0 W 0003315999 TEJAS BROADCASTING LTD., LLP Amarillo 04/24/2008 00949.62500 35-11-32.0 N IN MD WGR842 085-05-59.0 W 0003405371 PATHFINDER COMMUNICATIONS CORFORT WAYNE 04/21/2008 00948.50000 41-00-12.0 N IN MD WGR842 085-05-59.0 W 0003405371 PATHFINDER COMMUNICATIONS CORFORT WAYNE 04/21/2008 00950.50000 41-00-12.0 N NM MD WPXT310 105-57-07.0 W 0003407558 SOUTHERN NEW MEXICO RADIO FOUNAlamogordo 04/22/2008 00948.42500 32-55-40.0 N CO MD WQHX970 104-38-04.2 W 0003411018 UNITED STATES CP, LLC PUEBLO 04/25/2008 00946.00000 38-18-38.5 N Page 2 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 119-12-33.0 W 0003407203 GOLD COAST BROADCASTING LLC Ventura 04/22/2008 00951.50000 34-15-11.0 N KY NE 086-26-54.0 W 0003408311 NEWBERRY BROADCASTING, INC. BOWLING GREEN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281980A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281980A1.txt
  • Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WV MD WLO799 080-59-20.3 W 0003421771 WEST VIRGINIA EDUCATIONAL BROADLayland 04/30/2008 06875.00000 - 06900.00000 37-53-46.4 N TP - TV Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KA88725 P 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO. LOS ANGELES 05/02/2008 01990.00000 - 02008.00000 34-09-19.0 N Page 8 TP - TV Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KA88725 P 118-20-04.2 W 0003265716 NBC TELEMUNDO LICENSE CO. LOS ANGELES 05/02/2008 01990.00000 - 02008.00000 34-09-19.0 N CA AM KA88725 P
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282120A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282120A1.txt
  • OF 05/09/2008 RO WPI6 0003433236 CHANDLER, CITY OF 05/09/2008 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City HI NE 156-27-04.0 W 0003427231 HOCHMAN HAWAII PUBLISHING, INC.Kihei 05/05/2008 00948.00000 20-46-19.0 N MS NE 088-56-55.2 W 0003430024 KUDZU COMMUNICATIONS, INC. Ripley 05/06/2008 00948.50000 34-43-50.3 N WI NE 088-35-04.2 W 0003432502 CUMULUS LICENSING LLC Oshkosh 05/08/2008 00944.37500 44-00-50.4 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO KPE352 0003426288 Cal-Ore Telephone Co. 05/05/2008 RO KMM686 0003426289 Cal-Ore Telephone Co. 05/05/2008 RO KFL913 0003427074 CLEAR LAKE INDEPENDENT TELEPHO 05/05/2008 RO KUS222 0003428511 BLACKDUCK TELEPHONE COMPANY
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282287A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282287A1.txt
  • GROVE 05/12/2008 06825.00000 33-17-24.4 N Page 22 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IA NE 094-02-22.6 W 0003433930 USCOC OF GREATER IOWA, INC. LEHIGH 05/12/2008 06805.00000 42-21-27.2 N PA NE 078-40-00.6 W 0003433992 Allegheny Bradford Corporation Lewis Run 05/12/2008 19325.00000 41-52-04.2 N PA NE 078-39-20.9 W 0003433998 Allegheny Bradford Corporation Lewis Run 05/12/2008 17765.00000 41-52-20.6 N TX NE 098-28-56.5 W 0003434267 Choice Wireless, LC WICHITA FALLS 05/12/2008 06845.00000 33-47-45.5 N AZ NE 110-47-27.0 W 0003434901 Gila River Cellular General Partnership Globe 05/12/2008 23365.00000 33-24-01.5 N CA NE 121-14-19.5 W 0003435720 MetroPCS California LLC Manteca 05/13/2008 17905.00000 37-47-48.6 N CA NE 121-18-11.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282366A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282366A1.txt
  • of this Public Notice. Opposition to objections may be filed no later than 10 days after the original objection is filed. Responses to the opposition may be filed no later than 5 days after the time for filing an opposition has expired. AApppplliiccaanntt FFiillee N Nuum mbbeerr C Coooorrddiinnaatteess D Daattee R Reecc''dd Southeast Towers, LLC k/n/a Diamond Towers A0594431 33-43-04.2/084-24-29.9 5/16/08 SBA Structures Inc. A0594758 46-39-21.5/092-10-26.8 5/21/08 AT&T California A0594757 38-00-29.9/121-32-10.2 5/21/08 -FCC-
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282424A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282424A1.txt
  • W 0003442760 NEW CINGULAR WIRELESS PCS, LLCGila Bend 05/20/2008 06815.00000 32-56-04.3 N AZ MD WQDK698 111-46-03.8 W 0003442304 NEW CINGULAR WIRELESS PCS, LLCCHANDLER 05/19/2008 23030.00000 33-15-13.9 N AZ MD WQDK698 111-46-03.8 W 0003442304 NEW CINGULAR WIRELESS PCS, LLCCHANDLER 05/19/2008 23180.00000 33-15-13.9 N SC MD WQHP989 082-04-56.9 W 0003442402 Conterra Ultra Broadband, LLC Startex 05/19/2008 10715.00000 34-56-01.5 N SC MD WQHP942 082-16-04.2 W 0003442407 Conterra Ultra Broadband, LLC Taylors 05/19/2008 11215.00000 34-56-49.4 N AZ MD WQCU380 111-53-32.7 W 0003445886 New Cingular Wireless PCS, LLC SUN LAKES 05/20/2008 23080.00000 33-13-24.3 N Page 2 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD WQDK553 111-50-22.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.txt
  • . . . . . . . .. . . . . . Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2006. . . . . . . . . . . . . . . . . . . . . . . . . . . . . Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006. . . . . . .
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.txt
  • as of December 31, 2005 (Dollar Amounts Shown in Millions) Total Non- Subject to State Interstate Access Billing and Regulated Separations Collection and Common Traffic Special Total and Adjustments Line Sensitive Interexchange All Reporting Cos. ($1,956.1) $4,341.0 ($6,297.1)($7,243.2) $4,917.8 $2,652.8 $802.0 $1,426.7 $4,881.5 $36.3 Bell Operating Cos. (2,960.3) 3,677.7 (6,638.0) (7,456.3) 4,712.8 2,515.7 767.1 1,395.6 4,678.4 34.3 All Other Cos. 1,004.2 663.4 340.9 213.1 204.9 137.0 34.8 31.1 202.9 1.9 Alabama 301.0 284.5 16.6 (18.3) 106.4 66.7 12.9 24.8 104.4 2.0 AL Arizona (3,080.1) (2,536.2) (543.9) (551.8) 30.5 18.9 4.1 7.4 30.4 AZ Arkansas (75.2) 31.1 (106.3) (108.4) (3.5) (2.2) (0.5) (0.8) (3.5) AR California (1,065.0) (60.5) (1,004.5) (1,089.0) 808.3 418.5 154.8 231.4 804.7 3.5 CA Colorado 1,826.2 1,414.3 412.0 395.5
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282830A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282830A1.txt
  • 0003464768 Cellco Partnership MURPHYSBORO 06/06/2008 06801.25000 37-46-34.1 N IL MD WPNG353 089-21-41.3 W 0003464768 Cellco Partnership MURPHYSBORO 06/06/2008 06815.00000 37-46-34.1 N Page 18 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPQL781 089-28-25.3 W 0003464773 Cellco Partnership GORHAM 06/06/2008 06705.00000 37-41-04.2 N ID MD WMS688 116-46-46.7 W 0003464797 Verizon Wireless (VAW) LLC COEUR D'ALENE 06/06/2008 06745.00000 47-41-56.6 N ID MD WMS688 116-46-46.7 W 0003464797 Verizon Wireless (VAW) LLC COEUR D'ALENE 06/06/2008 06795.00000 47-41-56.6 N ID MD WMS688 116-46-46.7 W 0003464797 Verizon Wireless (VAW) LLC COEUR D'ALENE 06/06/2008 06825.00000 47-41-56.6 N CA MD WLL501 119-17-20.1 W 0003464805 NEW CINGULAR WIRELESS PCS, LLCDELANO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283016A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283016A1.txt
  • Jamul 06/10/2008 19540.00000 32-41-50.7 N KS NE P 096-26-12.0 W 0003467984 ONEOK, Inc. Frankfort 06/10/2008 00956.40625 39-49-13.0 N KS NE P 096-14-34.0 W 0003468008 ONEOK, Inc. Louisville 06/10/2008 00956.40625 39-20-33.0 N MT NE 114-11-58.5 W 0003468393 Cutthroat Communications Kalispell 06/11/2008 06585.00000 48-22-25.9 N GA NE 084-10-14.0 W 0003468394 CLEARWIRE SPECTRUM HOLDINGS II Stone Mountain 06/11/2008 18040.00000 33-48-07.7 N CA NE 116-14-04.2 W 0003468395 METROPOLITAN AREA NETWORKS, INBermuda Dunes 06/11/2008 06404.79000 33-45-57.6 N CA NE 116-49-21.0 W 0003468396 METROPOLITAN AREA NETWORKS, INIdyllwild 06/11/2008 10755.00000 33-50-23.0 N Page 35 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 117-15-06.0 W 0003468397 METROPOLITAN AREA NETWORKS, INPERRIS 06/11/2008 10875.00000 33-44-07.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283198A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283198A1.txt
  • 06/19/2008 00122.80000 34-30-09.2 N WI NE 088-29-31.4 W 0003473469 Aviation Spectrum Resources, Inc Fond Du Lac 06/17/2008 00129.47500 43-46-26.9 N TX NE 097-02-16.8 W 0003473472 Aviation Spectrum Resources, Inc Dallas 06/17/2008 00131.72500 32-53-48.6 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY NE 084-40-04.2 W 0003473476 Aviation Spectrum Resources, Inc Covington 06/17/2008 00130.40000 39-02-55.8 N ID NE 113-46-23.3 W 0003473482 Aviation Spectrum Resources, Inc May 06/17/2008 00130.30000 44-26-34.4 N ND NE 097-10-34.0 W 0003473483 Aviation Spectrum Resources, Inc Grand Forks 06/17/2008 00129.95000 47-56-57.0 N OR NE 122-35-51.0 W 0003473485 Aviation Spectrum Resources, Inc Portland 06/17/2008 00129.80000 45-35-19.0 N WA NE 122-18-33.5 W 0003473492 Aviation
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283397A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283397A1.txt
  • SPECTRUM HOLDINGS II Portland 06/23/2008 23075.00000 45-29-26.9 N OR NE 122-40-25.5 W 0003483140 CLEARWIRE SPECTRUM HOLDINGS II Portland 06/23/2008 23125.00000 45-29-26.9 N OR NE 122-40-25.5 W 0003483140 CLEARWIRE SPECTRUM HOLDINGS II Portland 06/23/2008 23175.00000 45-29-26.9 N WY NE 104-49-39.0 W 0003483196 Millhouse Electronics Inc Cheyenne 06/23/2008 17840.00000 41-10-32.6 N WY NE 104-46-19.5 W 0003483197 Millhouse Electronics Inc Cheyenne 06/23/2008 19400.00000 41-10-04.2 N IL NE 087-39-14.8 W 0003483886 AWB American Wireless Broadband LLCChicago 06/24/2008 17980.00000 41-59-10.8 N CA NE 121-02-14.1 W 0003484902 MedAmerica Modesto 06/24/2008 21925.00000 37-39-33.6 N CA NE 121-45-24.0 W 0003484920 Nextweb Inc San Jose 06/24/2008 21370.00000 37-21-33.0 N IL NE 087-44-16.1 W 0003484925 UNIION PACIFIC RAILROAD WATSEKA 06/24/2008 00928.20625 40-46-31.1 N IL NE 087-44-16.1 W 0003484925 UNIION PACIFIC RAILROAD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283520A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283520A1.txt
  • Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN RM KNKD671 083-54-52.7 W 0003491912 Metrocall USA, Inc Knoxville 07/01/2008 00152.84000 35-57-21.3 N TN RM KNKD671 083-56-55.6 W 0003491912 Metrocall USA, Inc KNOXVILLE 07/01/2008 00152.84000 35-59-59.2 N TN RM KNKD671 083-52-59.6 W 0003491912 Metrocall USA, Inc KNOXVILLE 07/01/2008 00152.84000 36-04-04.2 N Page 2 CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN RM KNKD671 083-57-29.6 W 0003491912 Metrocall USA, Inc MARYVILLE 07/01/2008 00158.10000 35-45-23.2 N TN RM KNKD671 084-14-08.7 W 0003491912 Metrocall USA, Inc OAK RIDGE 07/01/2008 00152.84000 36-02-29.2 N SC RM KNKE204 080-32-17.2 W 0003491929
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283613A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283613A1.txt
  • ffiilleedd bbyy tthhee aapppplliiccaannttss,, lliisstteedd hheerreeiinn,, tthhaatt tthhee pprrooppoosseedd ttoow weerr w wiillll nnoott hhaavvee aannyy ssiiggnniiffiiccaanntt iim mppaacctt uuppoonn tthhee eennvviirroonnm meenntt.. SSeeee 4477 C C..FF.. R R.. §§ 11..11330088((dd)).. AAccccoorrddiinnggllyy,, tthhee aapppplliiccaattiioonn((ss)) lliisstteedd hheerreeiinn ffoorr mmaajjoorr eennvviirroonnmmeennttaall aaccttiioonnss aarree GGRRAANNTTEEDD.. AApppplliiccaanntt FFiillee N Nuum mbbeerr C Coooorrddiinnaatteess D Daattee R Reecc''dd Southeast Towers, LLC k/n/a Diamond Towers A0594431 33-43-04.2/084-24-29.9 5/16/08 Applications were WITHDRAWN by the applicant. A Apppplliiccaanntt FFiillee N Nuum mbbeerr C Coooorrddiinnaatteess D Daattee R Reecc''dd N Neew w C Ciinngguullaarr W Wiirreelleessss PPC CSS,, LLLLC C A A00555588225533 2266--1155--4455..11//008800--0066--0022..22 88//1155//0077 AT&T California A0594757 38-00-29.9/121-32-10.2 5/21/08 --FFC CC C--
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283719A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283719A1.txt
  • N VA NE 077-18-25.4 W 0003499957 FiberTower Network Services Corp. FAIRFAX 07/10/2008 10835.00000 38-49-55.0 N MD NE 076-27-37.3 W 0003499961 FiberTower Network Services Corp. Perry Hall 07/10/2008 10875.00000 39-24-54.3 N DC NE 077-01-26.3 W 0003499963 FiberTower Network Services Corp. Washington 07/10/2008 21870.00000 38-55-25.6 N VA NE 077-10-54.0 W 0003499965 FiberTower Network Services Corp. SPRINGFIELD 07/10/2008 11215.00000 38-46-52.0 N MD NE 076-53-04.2 W 0003499966 FiberTower Network Services Corp. Laurel 07/10/2008 11155.00000 39-05-55.1 N MD NE 076-51-41.2 W 0003499971 FiberTower Network Services Corp. FORESTVILLE 07/10/2008 21920.00000 38-50-58.0 N MD NE 076-53-38.6 W 0003499972 FiberTower Network Services Corp. CLINTON 07/10/2008 10835.00000 38-46-50.5 N MD NE 076-34-00.1 W 0003499973 FiberTower Network Services Corp. ANNAPOLIS 07/10/2008 23020.00000 38-58-11.3 N MN NE 093-01-23.3 W 0003500055 Telecom Transport
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284158A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284158A1.txt
  • NY MTA License, LLC CHATSWORTH 07/22/2008 17895.00000 34-19-41.3 N CA MD WQCJ972 118-35-50.9 W 0003511816 Omnipoint NY MTA License, LLC CHATSWORTH 07/22/2008 17925.00000 34-19-41.3 N CA MD WQCJ972 118-35-50.9 W 0003511816 Omnipoint NY MTA License, LLC CHATSWORTH 07/22/2008 17950.00000 34-19-41.3 N CA MD WQCJ972 118-35-50.9 W 0003511816 Omnipoint NY MTA License, LLC CHATSWORTH 07/22/2008 18110.00000 34-19-41.3 N IL MD WQFK526 087-59-04.2 W 0003511825 FiberTower Network Services Corp. LEMONT 07/22/2008 10755.00000 41-40-16.1 N IL MD WQFK526 087-59-04.2 W 0003511825 FiberTower Network Services Corp. LEMONT 07/22/2008 19460.00000 41-40-16.1 N OK MD WMG851 096-03-10.0 W 0003512014 UNITED STATES CELLULAR TELEPHONOAKHURST 07/22/2008 06660.00000 36-04-27.0 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284321A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284321A2.txt
  • 0.0 0.0 0.026.9 73.1 $4,891 0.0 0.0 0.0 0.0100.0 47,764,241 0.313.114.615.0 57.0 Mauritania $1,070,566 0.113.813.0 1.7 71.4 $75,780 0.0 0.0 0.0 0.0100.0 $1,423 0.0 0.0 0.0 0.0100.0 5,928,107 0.0 9.613.3 2.4 74.7 Mauritius $2,510,964 0.230.9 0.110.8 57.9 $265,327 0.0 0.0 0.0 0.0100.0 $9,919 0.0 0.0 0.0 0.0100.0 18,771,855 0.219.6 0.213.1 67.0 Morocco $28,659,734 0.014.1 7.111.1 67.8 $783,968 0.0 0.0 0.0 4.2 95.8 $8,025 0.0 0.0 0.0 0.0100.0 175,262,967 0.0 5.0 5.912.6 76.5 Mozambique $1,612,206 0.014.6 0.830.9 53.8 $54,446 0.0 0.0 0.0 0.0100.0 $236 0.0 0.0 0.0 0.0100.0 11,881,739 0.0 7.5 1.244.7 46.7 Namibia $1,015,108 0.312.2 0.1 8.0 79.4 $95,219 0.0 0.0 0.0 0.0100.0 $296 0.0 0.0 0.0 0.0100.0 7,263,238 0.2 5.7 0.0 7.3 86.8 Niger $1,962,299 0.017.3 0.125.8 56.7 $22,477 0.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284342A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284342A1.txt
  • 114-46-22.9 W 0003527797 LOS ANGELES SMSA LIMITED PARTNEBLYTHE 08/01/2008 06615.00000 33-37-03.1 N CA MD WPOR266 114-46-22.9 W 0003527797 LOS ANGELES SMSA LIMITED PARTNEBLYTHE 08/01/2008 06635.00000 33-37-03.1 N CA MD WPOR266 114-46-22.9 W 0003527797 LOS ANGELES SMSA LIMITED PARTNEBLYTHE 08/01/2008 06655.00000 33-37-03.1 N CA MD WPOR266 114-46-22.9 W 0003527797 LOS ANGELES SMSA LIMITED PARTNEBLYTHE 08/01/2008 10627.50000 33-37-03.1 N MI MD WLT678 085-40-04.2 W 0003528108 Alltel Telelink, Inc. Otsego 08/01/2008 02115.20000 42-30-25.3 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI MD WLT678 085-40-04.2 W 0003528108 Alltel Telelink, Inc. Otsego 08/01/2008 02121.60000 42-30-25.3 N MI MD WLT678 085-40-04.2 W 0003528108 Alltel Telelink,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284667A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284667A1.txt
  • Somerville 08/15/2008 17965.00000 42-23-07.2 N MA NE 071-05-24.0 W 0003547503 Boston, City of Roxbury 08/15/2008 17915.00000 42-20-04.4 N MA NE 071-04-48.6 W 0003547513 Boston, City of Cambridge 08/15/2008 19475.00000 42-22-08.7 N MA NE 071-07-16.9 W 0003547732 Boston, City of Brookline Village 08/15/2008 19375.00000 42-20-01.4 N MA NE 071-05-31.7 W 0003547737 Boston, City of Somerville 08/15/2008 18065.00000 42-22-43.8 N MA NE 070-59-04.2 W 0003547756 Boston, City of Winthrop 08/15/2008 17765.00000 42-22-36.3 N MA NE 070-59-04.2 W 0003547756 Boston, City of Winthrop 08/15/2008 18015.00000 42-22-36.3 N MA NE 071-05-41.9 W 0003547964 Boston, City of SUFFOLK 08/15/2008 23070.00000 42-16-55.9 N RO WPNC825 0003542087 City of Fayetteville AR 08/11/2008 RO WPNM317 0003542088 City of Fayetteville AR 08/11/2008 RO WNTU483 0003542184 County of Centre 08/11/2008 RO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284856A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284856A1.txt
  • 33-42-42.5 N CA NE 118-14-14.4 W 0003550790 AIR SITES 2000 LLC Tujunga 08/18/2008 06256.54000 34-16-06.8 N CA NE 118-14-14.4 W 0003550790 AIR SITES 2000 LLC Tujunga 08/18/2008 10795.00000 34-16-06.8 N CA NE 118-14-14.4 W 0003550790 AIR SITES 2000 LLC Tujunga 08/18/2008 11035.00000 34-16-06.8 N CA NE 119-11-15.2 W 0003550791 Air Sites 2000 LLC Ojai 08/18/2008 06286.19000 34-24-44.5 N CA NE 118-30-04.2 W 0003550794 Air Sites 2000 LLC North Hills 08/18/2008 11285.00000 34-13-45.1 N CA NE 118-30-04.2 W 0003550794 Air Sites 2000 LLC North Hills 08/18/2008 11325.00000 34-13-45.1 N MI NE P 082-30-32.0 W 0003550955 COTTREVILLE TOWNSHIP MARINE CITY 08/19/2008 00952.39375 42-42-06.0 N MI NE P 084-34-19.6 W 0003550967 SUPERIOR TOWNSHIP BRIMLEY 08/19/2008 00956.38125 46-24-19.3 N NY NE 073-44-06.4 W 0003551045 Northrop
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284929A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284929A1.txt
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by incumbent LECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284932A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284932A1.txt
  • 143,341,581 2.8 142,367,463 2.0 1993 148,106,159 3.3 147,033,132 3.3 1994 153,447,946 3.6 151,543,061 3.1 1995 159,658,662 4.0 158,152,644 4.4 1996 166,445,580 4.3 165,350,308 4.6 1997 173,866,799 4.5 173,857,193 5.1 1998 179,849,045 3.4 180,516,161 3.8 1999 189,397,096 185,002,911 2.9 186,594,497 3.4 2000 192,432,431 1.6% 188,499,586 1.9 187,581,092 0.5 2001 191,570,800 -0.4 185,587,160 -1.5 179,811,283 -4.1 2002 189,250,143 -1.2 180,095,333 -3.0 172,245,846 -4.2 2003 182,933,281 -3.3 173,140,710 -3.9 161,374,473 -6.3 2004 177,690,711 -2.9 165,979,938 -4.1 154,039,066 -4.5 2005 175,160,940 -1.4 157,037,503 -5.4 147,993,264 -3.9 2006 167,504,016 -4.4 146,848,926 -6.5 140,029,044 -5.4 1 Include end-user switched access lines for competitive local exchange carriers (CLECs) and incumbent local exchange carriers (ILECs) as reported in FCC Form 477. Prior to June 2005, only carriers with greater
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285241A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285241A1.txt
  • Bozeman 09/03/2008 00952.08125 45-41-20.8 N HI AM 159-27-44.9 W 0003507720 HAWAII, STATE OF Lihue 09/04/2008 00942.57500 21-58-29.7 N HI AM 159-27-44.9 W 0003507720 HAWAII, STATE OF Lihue 09/04/2008 00943.37500 21-58-29.7 N HI AM 159-21-18.5 W 0003507759 HAWAII, STATE OF Lihue 09/04/2008 00934.37500 21-58-37.0 N HI AM 159-18-45.9 W 0003507772 HAWAII, STATE OF LIHUE 09/04/2008 00933.57500 22-08-15.0 N WA MD WQHY899 120-23-04.2 W 0003564845 WASHINGTON, STATE OF YAKIMA 08/29/2008 06197.24000 46-38-26.8 N WA MD WQHY899 120-23-04.2 W 0003564845 WASHINGTON, STATE OF YAKIMA 08/29/2008 11445.00000 46-38-26.8 N Page 1 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA MD WHC583 120-26-32.2 W 0003564849 WASHINGTON, STATE OF THRALL 08/29/2008
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285435A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285435A1.txt
  • (ALSAT) E8309 SES-RWL-20080915-01199 E Date Effective: 09/15/2008 Class of Station: Fixed Earth Stations Grant of Authority 12/02/2008 - 12/02/2023 Renewal Time Warner Entertainment - Advance/Newhouse Partnership Nature of Service: Domestic Fixed Satellite Service 43 ° 8 ' 53.00 " N LAT. SITE ID: 1 MONROE, ROCHESTER, NY 77 ° 36 ' 33.00 " W LONG. LOCATION: PICO SATELLITE SAR-1 1 4.2 meters ANTENNA ID: 4 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E080120 SES-STA-20080616-00788 E Date Effective: 09/12/2008 Class of Station: Grant of Authority Special Temporary Authority EchoStar Corporation Special temporary authority is GRANTED for a period of 30 days commencing September 12, 2008 and ending October 11, 2008. Points of Communication: E070014 SES-STA-20080616-00789 E
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285754A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285754A1.txt
  • Oakdale 09/25/2008 23310.00000 44-58-57.4 N MN NE 092-59-38.0 W 0003593017 Telecom Transport Management, Inc. Maplewood 09/25/2008 22460.00000 44-55-18.1 N MN NE 092-57-16.9 W 0003593019 Telecom Transport Management, Inc. Oakdale 09/25/2008 21280.00000 44-58-01.6 N MN NE 092-54-27.7 W 0003593028 Telecom Transport Management, Inc. Woodbury 09/25/2008 23210.00000 44-55-07.0 N MN NE 093-00-30.6 W 0003593033 Telecom Transport Management, Inc. St. Paul 09/25/2008 22510.00000 44-56-04.2 N MN NE 093-04-43.9 W 0003593035 Telecom Transport Management, Inc. WEST SAINT PAUL 09/25/2008 21410.00000 44-53-30.1 N MN NE 093-08-44.5 W 0003593038 Telecom Transport Management, Inc. St. Paul 09/25/2008 21360.00000 44-54-45.7 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286178A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286178A1.txt
  • 0003611994 NE Colorado Wireless Technologies, Inc.Platte Center 10/16/2008 06063.80000 41-32-37.8 N NE MD WPZA769 100-31-07.0 W 0003611996 NE Colorado Wireless Technologies, Inc.Maxwell 10/16/2008 06256.54000 41-07-41.9 N SC MD WQJA451 082-58-49.8 W 0003612015 Conterra Ultra Broadband LLC Fair Play 10/16/2008 11245.00000 34-30-16.2 N SC MD WQHS310 082-30-09.7 W 0003612042 Conterra Ultra Broadband, LLC PIEDMONT 10/16/2008 06034.15000 34-42-18.6 N SC MD WQHP942 082-16-04.2 W 0003612049 Conterra Ultra Broadband, LLC Taylors 10/16/2008 05945.20000 34-56-49.4 N SC MD WQHS309 082-41-59.0 W 0003612068 Conterra Ultra Broadband, LLC ANDERSON 10/16/2008 06034.15000 34-26-27.0 N SC MD WQHS309 082-41-59.0 W 0003612068 Conterra Ultra Broadband, LLC ANDERSON 10/16/2008 06093.45000 34-26-27.0 N SC MD WQHS309 082-41-59.0 W 0003612068 Conterra Ultra Broadband, LLC ANDERSON 10/16/2008 06152.75000 34-26-27.0 N Page 10 CF -
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286358A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286358A1.txt
  • Number Frequency (MHz) Applicant Name Latitude City CA MD WNEU744 120-01-49.6 W 0003618690 Pacific Gas and Electric Company MOUNT BULLION 10/23/2008 00928.66250 37-32-04.7 N CA MD WNEU744 120-01-49.6 W 0003618690 Pacific Gas and Electric Company MOUNT BULLION 10/23/2008 00952.30625 37-32-04.7 N CA MD WNEU744 120-01-49.6 W 0003618690 Pacific Gas and Electric Company MOUNT BULLION 10/23/2008 00952.66250 37-32-04.7 N CA NE 119-02-04.2 W 0003614914 Vintage Production California LLC KERN 10/20/2008 06093.45000 35-00-27.7 N CA NE 119-02-24.7 W 0003614917 Vintage Production California LLC KERN 10/20/2008 06345.49000 35-29-33.7 N OR NE P 124-15-16.6 W 0003615030 HARBOR WATER PUD HARBOR 10/20/2008 00956.31875 42-02-32.8 N UT NE 111-51-15.7 W 0003615359 Intermountain Health Care Inc. SANDY 10/20/2008 17820.00000 40-34-35.2 N MO NE 090-14-12.0 W 0003615512 Wisper ISP
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286852A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286852A1.txt
  • 16 Nature of Service: Domestic Mobile-Satellite Service, International Mobile Satellite Service, Mobile Satellite Service Modification application filed to increase the total number of mobile terminals in its current blanket authorization from 100,000 to 450,000, and to include additional points of communications. SITE ID: MOBILE 100,000 half-duplex METs CONUS, Alaska, HI & surrounding US water, VARIOUS LOCATION: Eagle Eye, Inc. (ant. size:4.2cm Square) MT1 0.042 meters ANTENNA ID: Ant. Type: Patch 4.00 dBW MSK at 3600 bps; digital; data 1626.5000 - 1660.5000 MHz 4K00F1D reception of GPS L1 CA signal 1574.4200 - 1576.4200 MHz 1M00G1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K00F1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K7G1D 4.00 dBW MSK at 3600
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286957A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286957A1.txt
  • N MS MD KNKN619 088-31-17.2 W 0003650662 ALLTEL Communications of Mississippi RLauderdale 11/14/2008 32-30-40.7 N MS MD KNKN619 088-43-36.2 W 0003650662 ALLTEL Communications of Mississippi RMERIDAN 11/14/2008 32-24-23.5 N MS MD KNKN619 088-41-31.5 W 0003650662 ALLTEL Communications of Mississippi RMERIDIAN 11/14/2008 32-19-04.8 N MS MD KNKN619 089-05-04.0 W 0003650662 ALLTEL Communications of Mississippi RNEWTON 11/14/2008 32-22-03.0 N MS MD KNKN619 089-09-04.2 W 0003650662 ALLTEL Communications of Mississippi RNoxapater 11/14/2008 33-00-20.8 N MS MD KNKN619 089-41-02.0 W 0003650662 ALLTEL Communications of Mississippi ROFAHOMA 11/14/2008 32-35-25.0 N MS MD KNKN619 089-05-55.3 W 0003650662 ALLTEL Communications of Mississippi RPHILADELPHIA 11/14/2008 32-43-35.1 N MS MD KNKN619 088-34-54.1 W 0003650662 ALLTEL Communications of Mississippi RRUSSELL 11/14/2008 32-25-42.5 N MS MD KNKN619 088-31-02.9 W 0003650662 ALLTEL Communications
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286958A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286958A1.txt
  • Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR NE 094-10-02.0 W 0003654188 Go Fayetteville LLC Fayetteville 11/19/2008 00123.00000 36-00-03.0 N FL NE 082-27-32.9 W 0003656968 HILLSBOROUGH COUNTY HOSPITAL ATampa 11/21/2008 00122.82500 27-56-17.3 N FL NE 080-50-04.2 W 0003657217 Titusville-Cocoa Airport Authority Titusville 11/21/2008 00123.00000 28-37-21.0 N RO KRR9 0003654454 VIRGINIA, COMMONWEALTH OF 11/19/2008 RO WPL4 0003654455 VIRGINIA, COMMONWEALTH OF 11/19/2008 RO KKJ8 0003655474 State of Montana, Aeronautics Division 11/19/2008 RO KPE7 0003656595 GRATIOT COMMUNITY AIRPORT COMM 11/21/2008 RO KNF9 0003656978 VERMILION COUNTY AIRPORT AUTHO 11/21/2008 Page 1 AF - Aeronautical and Fixed State Purpose Call Sign
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286967A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286967A1.txt
  • 2 10/23/2008 KCC523 FB MIDDLEFIELD, TOWN OF 153.93500000 MIDDLEFIELD 41-30-55.4 N CT 72-43-40.3 W 1 2 10/23/2008 KCC523 MO MIDDLEFIELD, TOWN OF 153.80000000 -- -- 2 1 10/23/2008 KCC523 MO MIDDLEFIELD, TOWN OF 153.93500000 -- -- 2 1 10/19/2008 KEH911 MO ULSTER, COUNTY OF 151.23500000 -- -- 4 1 10/19/2008 KSR881 FB2 MERRIMACK, TOWN OF 153.98000000 MERRIMACK 42-50-19.3 N NH 71-31-4.2 W 1 2 10/19/2008 KSR881 MO MERRIMACK, TOWN OF 155.97750000 -- -- 6 1 10/23/2008 WQDI362 MO SHORTSVILLE, VILLAGE OF 458.55000000 SHORTSVILLE 42-57-19.0 N NY 77-13-16.0 W 3 1 Page 2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286977A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286977A1.txt
  • Inc. Nature of Service: Domestic Mobile-Satellite Service, International Mobile Satellite Service, Mobile Satellite Service Modification application filed to increase the total number of mobile terminals in its current blanket authorization from 100,000 to 450,000, and to include additional points of communications. SITE ID: MOBILE 450,000 half-duplex METs CONUS, Alaska, HI & surrounding US water, VARIOUS LOCATION: Eagle Eye, Inc. (ant. size:4.2cm Square) MT1 0.042 meters ANTENNA ID: Ant. Type: Patch 4.00 dBW MSK at 3600 bps; digital; data 1626.5000 - 1660.5000 MHz 4K00F1D reception of GPS L1 CA signal 1574.4200 - 1576.4200 MHz 1M00G1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K00F1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K70G1D 4.00 dBW MSK at 3600
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287093A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287093A1.txt
  • 37-44-21.0 N IL MD KNKN820 088-28-35.2 W 0003657395 Southern Illinois RSA Partnership d/b/a AlHerod 11/24/2008 37-34-52.2 N IL MD KNKN820 088-28-34.0 W 0003657395 Southern Illinois RSA Partnership d/b/a AlHerod 11/24/2008 37-34-54.0 N IL MD KNKN820 088-12-47.1 W 0003657395 Southern Illinois RSA Partnership d/b/a AlHERRIN 11/24/2008 37-31-52.2 N IL MD KNKN820 087-43-16.5 W 0003657395 Southern Illinois RSA Partnership d/b/a AlLAWRENCEVILLE 11/24/2008 38-43-04.2 N IL MD KNKN820 088-30-08.9 W 0003657395 Southern Illinois RSA Partnership d/b/a AlLOUISVILLE 11/24/2008 38-44-40.1 N IL MD KNKN820 088-34-04.9 W 0003657395 Southern Illinois RSA Partnership d/b/a AlMC LEANSBORO 11/24/2008 38-03-12.5 N IL MD KNKN820 088-42-56.9 W 0003657395 Southern Illinois RSA Partnership d/b/a AlMetropolis 11/24/2008 37-14-23.7 N IL MD KNKN820 087-45-54.0 W 0003657395 Southern Illinois RSA Partnership d/b/a AlMT. CARMEL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287094A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287094A1.txt
  • N MS AM KNKN619 088-31-17.2 W 0003650662 ALLTEL Communications of Mississippi RLauderdale 11/25/2008 32-30-40.7 N MS AM KNKN619 088-43-36.2 W 0003650662 ALLTEL Communications of Mississippi RMERIDAN 11/25/2008 32-24-23.5 N MS AM KNKN619 088-41-31.5 W 0003650662 ALLTEL Communications of Mississippi RMERIDIAN 11/25/2008 32-19-04.8 N MS AM KNKN619 089-05-04.0 W 0003650662 ALLTEL Communications of Mississippi RNEWTON 11/25/2008 32-22-03.0 N MS AM KNKN619 089-09-04.2 W 0003650662 ALLTEL Communications of Mississippi RNoxapater 11/25/2008 33-00-20.8 N MS AM KNKN619 089-41-02.0 W 0003650662 ALLTEL Communications of Mississippi ROFAHOMA 11/25/2008 32-35-25.0 N MS AM KNKN619 089-05-55.3 W 0003650662 ALLTEL Communications of Mississippi RPHILADELPHIA 11/25/2008 32-43-35.1 N MS AM KNKN619 088-34-54.1 W 0003650662 ALLTEL Communications of Mississippi RRUSSELL 11/25/2008 32-25-42.5 N MS AM KNKN619 088-31-02.9 W 0003650662 ALLTEL Communications
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287239A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287239A1.txt
  • 19320.00000 36-07-51.8 N AZ NE 111-14-12.4 W 0003667298 Wecom, Inc Tuba City 12/04/2008 17760.00000 38-08-09.1 N MN NE 093-03-15.8 W 0003667310 Telecom Transport Management, Inc. White Bear Lake 12/04/2008 22160.00000 45-04-54.8 N MN NE 093-01-38.7 W 0003667317 Telecom Transport Management, Inc. St. Paul 12/04/2008 22680.00000 44-57-11.7 N MN NE 093-00-30.6 W 0003667339 Telecom Transport Management, Inc. St. Paul 12/04/2008 22510.00000 44-56-04.2 N MN NE 092-54-53.3 W 0003667351 Telecom Transport Management, Inc. Woodbury 12/04/2008 21380.00000 44-56-51.4 N MN NE 093-15-04.3 W 0003667363 Telecom Transport Management, Inc. Minneapolis 12/04/2008 21260.00000 44-59-26.5 N RI NE 071-16-01.5 W 0003667410 Towerstream Corp Warren 12/04/2008 19425.00000 41-44-16.1 N RI NE 071-16-01.5 W 0003667410 Towerstream Corp Warren 12/04/2008 19475.00000 41-44-16.1 N RI NE 071-25-08.2 W 0003667411 Towerstream Corp
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287532A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287532A1.txt
  • the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD KWP6 083-48-22.8 W 0003677385 GRAND AIRE EXPRESS Toldeo 12/15/2008 00122.87500 41-35-31.1 N CA NE 121-42-04.2 W 0003678316 Rio Vista Airport Rio Vista 12/16/2008 00122.72500 38-11-31.3 N FL NE 081-03-31.2 W 0003678379 Precision Aviation Group, Inc. Daytona Beach 12/16/2008 00122.95000 29-11-08.9 N MI NE 085-33-05.6 W 0003679955 Aviation Spectrum Resources, Inc Kalamazoo 12/17/2008 00130.95000 42-14-03.8 N TX NE 095-33-10.0 W 0003679961 Aviation Spectrum Resources, Inc Houston 12/17/2008 00130.00000 30-03-42.0 N OH NE 081-29-10.9 W 0003679982 Aviation
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A1.pdf
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 5 Index of Tables and Charts Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A11.pdf
  • 8.2 75.4 6.9 28.5 17.3 3.4 17.3 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 97.7 99.5 91.8 98.9 97.0 88.2 96.6 97.9 95.8 Residence 98.4 99.6 91.9 99.0 97.3 92.1 96.7 98.1 96.0 Business 95.0 99.0 91.7 98.5 95.4 73.1 95.6 95.8 92.8 Average Installation Interval (days) 0.8 2.3 4.4 4.4 1.7 5.0 1.2 3.1 4.2 Residence 0.6 1.9 3.8 3.9 1.6 4.2 1.1 3.0 4.2 Business 1.5 4.3 6.0 6.9 2.3 8.2 1.9 3.6 4.3 Average Out of Service Repair Interval (hours) 17.4 20.1 17.8 17.2 18.0 40.1 18.5 16.0 23.7 Residence 17.5 21.2 18.2 17.5 18.0 43.4 19.1 16.5 24.1 Business 15.8 14.8 15.7 15.5 17.8 31.8 13.1 12.6 20.4 Initial Trouble Reports per
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A2.pdf
  • State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 5 Index of Tables and Charts Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A3.pdf
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. Through 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. Significant amounts of enhanced services, billing and collection,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A6.pdf
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for Funding Years 2005, 2006 and 2007. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A9.pdf
  • amended the Communications Act of 1934. 47 U.S.C. §§ 151 et seq. 1957 - 2007 1997 - 2007 CPI All Items 4.1 % 2.7% CPI All Services 5.0 3.3 CPI Telephone Services ** 1.2 -0.1 CPI Major Categories: - Food & Beverages * 2.7 - Housing * 3.0 - Apparel 2.2 -1.1 - Transportation 3.3 2.9 - Medical Care 5.1 4.2 - Recreation * 1.1 - Other Goods & Services * 3.9 CPI Public Transportation 4.5 2.4 CPI Utility Natural Gas Service 4.2 6.4 CPI Electricity 3.0 3.2 CPI Sewer & Water Maintenance 4.8 4.1 CPI Postage 4.3 2.7 *** Source: Bureau of Labor Statistics. Chart 7.1 The CPI telephone service index was revised in December of 1997. Table 7.1 Long-Term
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287727A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287727A1.txt
  • N TX NE 094-30-35.0 W 0003688439 Alltel New License Sub LLC TATUM 12/29/2008 06805.00000 32-18-44.2 N AK NE 147-43-58.1 W 0003688509 Alaska DigiTel, L.L.C. Fairbanks 12/29/2008 19675.00000 64-48-48.6 N CO NE 106-22-56.9 W 0003689457 CenturyTel Broadband Services, LLC Vail 12/30/2008 23170.00000 39-38-36.3 N CO NE 106-23-02.1 W 0003689461 CenturyTel Broadband Services, LLC Vail 12/30/2008 21970.00000 39-38-36.4 N CA RM WPOR717 118-00-04.2 W 0003690720 LOS ANGELES SMSA LIMITED PARTNEWESTMINSTER 01/02/2009 18040.00000 33-44-46.0 N CA RM WPOR717 118-00-04.2 W 0003690720 LOS ANGELES SMSA LIMITED PARTNEWESTMINSTER 01/02/2009 19525.00000 33-44-46.0 N RO WPOS358 0003688740 Verizon Wireless (VAW) LLC 12/30/2008 Page 4 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288105A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288105A1.txt
  • TX NE 095-36-48.8 W 0003701752 CENTERPOINT ENERGY INC SUGAR LAND 01/13/2009 00952.43125 29-39-53.8 N TX NE 095-36-48.8 W 0003701752 CENTERPOINT ENERGY INC SUGAR LAND 01/13/2009 00952.59375 29-39-53.8 N TX NE 095-36-48.8 W 0003701752 CENTERPOINT ENERGY INC SUGAR LAND 01/13/2009 00952.84375 29-39-53.8 N MD NE 076-35-55.0 W 0003701777 Baltimore Gas and Electric Company TOWSON 01/13/2009 10583.75000 39-24-04.1 N WY NE P 111-02-04.2 W 0003702403 BEAR RIVER REGIONAL JOINT POWERBEAR RIVER 01/14/2009 00956.34375 41-22-32.2 N CA NE 120-50-52.0 W 0003703854 IMS Inc., DBA Fire2wire HUGHSON 01/14/2009 11245.00000 37-34-46.0 N CA NE 120-50-10.6 W 0003703855 IMS Inc., DBA Fire2wire Oakdale 01/14/2009 10755.00000 37-45-25.8 N CA NE 120-50-10.6 W 0003703855 IMS Inc., DBA Fire2wire Oakdale 01/14/2009 10835.00000 37-45-25.8 N CA NE 120-59-50.3 W 0003703856 IMS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288107A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288107A1.txt
  • GEORGETOWN 01/23/2009 10628.12500 42-43-02.3 N MA MD WLV786 070-57-15.2 W 0003714615 CELLCO PARTNERSHIP GEORGETOWN 01/23/2009 10632.50000 42-43-02.3 N MA MD WLV786 070-57-15.2 W 0003714615 CELLCO PARTNERSHIP GEORGETOWN 01/23/2009 10652.50000 42-43-02.3 N MA MD WLV786 070-57-15.2 W 0003714615 CELLCO PARTNERSHIP GEORGETOWN 01/23/2009 10705.00000 42-43-02.3 N MD NE 076-48-37.8 W 0003710348 airBand Communications, Inc. Jonestown, MD 01/20/2009 10775.00000 39-13-35.4 N WY NE 111-01-04.2 W 0003711149 Union Telephone Company Alpine 01/21/2009 10622.50000 43-10-27.1 N SC NE 080-59-38.3 W 0003711247 Time Warner NY Cable LLC Rock Hill 01/21/2009 06063.80000 34-56-08.5 N CA NE 117-10-28.4 W 0003711361 Los Angeles SMSA Limited Partnership Highlands 01/21/2009 10587.50000 34-10-54.6 N CA NE 123-47-15.7 W 0003711919 Cellco Partnership Piercy 01/22/2009 11137.50000 39-57-55.2 N CA NE 123-44-12.1 W 0003711949 Cellco Partnership
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288108A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288108A1.txt
  • BRUSSELS 01/12/2009 06315.84000 44-44-56.0 N WI MD WQFZ364 088-28-15.0 W 0003699876 WISCONSIN DOT, STATE PATROL RUBICON 01/12/2009 06256.54000 43-20-53.0 N OH MD WNTD958 081-02-47.3 W 0003700776 GEAUGA, COUNTY OF Thompson 01/13/2009 06004.50000 41-41-28.2 N OH MD WNTD958 081-02-47.3 W 0003700776 GEAUGA, COUNTY OF Thompson 01/13/2009 06123.10000 41-41-28.2 N OH MD WNTD953 081-19-35.3 W 0003700780 GEAUGA, COUNTY OF Bainbridge 01/13/2009 10715.00000 41-23-04.2 N OH MD WNTD953 081-19-35.3 W 0003700780 GEAUGA, COUNTY OF Bainbridge 01/13/2009 10875.00000 41-23-04.2 N OH MD WNTD956 081-21-38.4 W 0003700785 GEAUGA, COUNTY OF SCOTLAND TOWNS 01/13/2009 11285.00000 41-31-55.2 N OH MD WNTD956 081-21-38.4 W 0003700785 GEAUGA, COUNTY OF SCOTLAND TOWNS 01/13/2009 11405.00000 41-31-55.2 N OH MD WNTD955 081-11-24.4 W 0003700788 GEAUGA, COUNTY OF Chardon 01/13/2009 06197.24000 41-30-20.2 N OH
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288116A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288116A1.txt
  • 1 - SOLIDARIDAD F-2 - (113.0 W.L.) E000725 SES-MFS-20081107-01453 E Date Effective: 01/26/2009 Class of Station: Mobile Earth Station Grant of Authority 03/13/2002 - 03/13/2012 Modification SkyBitz, Inc. Nature of Service: Domestic Mobile-Satellite Service, International Mobile Satellite Service, Mobile Satellite Service SITE ID: MOBILE 450,000 half-duplex METs CONUS, Alaska, HI & surrounding US water, VARIOUS LOCATION: Eagle Eye, Inc. (ant. size:4.2cm Square) MT1 0.042 meters ANTENNA ID: Ant. Type: Patch 4.00 dBW MSK at 3600 bps; digital; data 1626.5000 - 1660.5000 MHz 4K00F1D reception of GPS L1 CA signal 1574.4200 - 1576.4200 MHz 1M00G1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K00F1D MSK at 3600 bps; digital; data 1525.0000 - 1559.0000 MHz 4K70G1D 4.00 dBW MSK at 3600
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288793A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288793A1.txt
  • 0003743318 Fisher Wireless Services, Inc. 02/18/2009 00468.88750 MD WPYN822 A 0003743318 Fisher Wireless Services, Inc. 02/18/2009 00469.61250 MD WPYN822 A 0003743318 Fisher Wireless Services, Inc. 02/18/2009 00469.73750 MD WPYN822 A 0003743318 Fisher Wireless Services, Inc. 02/18/2009 00469.88750 MD WPYN822 A 0003743318 Fisher Wireless Services, Inc. 02/18/2009 00469.93750 CA MD WPYN822 116-08-21.1 W 0003743318 Fisher Wireless Services, Inc. Jacumba 02/18/2009 00461.93750 32-40-04.2 N CA MD WPYN822 116-08-21.1 W 0003743318 Fisher Wireless Services, Inc. Jacumba 02/18/2009 00463.53750 32-40-04.2 N CA MD WPYN822 116-08-21.1 W 0003743318 Fisher Wireless Services, Inc. Jacumba 02/18/2009 00463.88750 32-40-04.2 N CA MD WPYN822 116-08-21.1 W 0003743318 Fisher Wireless Services, Inc. Jacumba 02/18/2009 00464.61250 32-40-04.2 N CA MD WPYN822 116-08-21.1 W 0003743318 Fisher Wireless Services, Inc. Jacumba 02/18/2009 00464.73750 32-40-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288795A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288795A1.txt
  • W 0003742735 North Carolina State Highway Patrol Taylorsville 02/18/2009 11647.50000 35-52-07.9 N NC NE 080-06-02.4 W 0003742753 North Carolina State Highway Patrol Sandy Ridge 02/18/2009 06695.00000 36-29-37.8 N NC NE 080-06-02.4 W 0003742753 North Carolina State Highway Patrol Sandy Ridge 02/18/2009 06780.00000 36-29-37.8 N KS NE 094-54-15.9 W 0003743198 Johnson County Emergency CommunicatNew Century 02/18/2009 17720.00000 38-50-07.0 N TX NE 095-16-04.2 W 0003743258 HARRIS COUNTY ITC Humble 02/18/2009 06595.00000 29-59-57.6 N TX NE 095-01-04.5 W 0003743259 HARRIS COUNTY ITC BAYTOWN 02/18/2009 06315.84000 29-46-07.2 N TX NE 095-01-04.5 W 0003743259 HARRIS COUNTY ITC BAYTOWN 02/18/2009 06375.14000 29-46-07.2 N TX NE 095-11-32.8 W 0003743260 HARRIS COUNTY ITC Houston 02/18/2009 06123.10000 29-48-18.9 N TX NE 095-20-51.5 W 0003743262 HARRIS COUNTY ITC CONROE 02/18/2009 05974.85000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288977A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288977A1.txt
  • WIRELESS, LLC BRAINTREE 02/26/2009 11155.00000 42-13-54.6 N Page 11 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY NE 084-51-08.9 W 0003755093 KENTUCKY UTILITIES COMPANY BROMLEY 02/27/2009 06123.10000 38-37-10.4 N CA NE 117-48-03.7 W 0003755342 SKYRIVER COMMUNICATIONS San Dimas 02/27/2009 11665.00000 34-09-16.4 N AR NE P 093-33-04.2 W 0003755482 OZAN CREEK WATER FACILITIES BOARHOPE 02/27/2009 00956.41875 33-48-48.0 N KY NE P 087-49-25.3 W 0003755498 CITY OF CLAY CLAY 02/27/2009 00956.40625 37-28-14.2 N IL NE P 088-03-00.6 W 0003755534 VILLAGE OF ISLAND LAKE GRAYSLAKE 02/27/2009 00956.28125 42-22-06.0 N RO WNTU601 0003754563 GTECH CORPORATION 02/26/2009 RO WNTU667 0003754564 GTECH CORPORATION 02/26/2009 RO WNTV326 0003754728 MIAMI DADE - WATER AND
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289105A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289105A1.txt
  • to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD NE 076-43-59.6 W 0003757865 AT&T CORP. CATONSVILLE 03/03/2009 10945.00000 39-17-10.7 N UT NE 109-17-18.1 W 0003757875 UINTAH BASIN ELECTRONIC TELECOMBONANZA 03/03/2009 11215.00000 40-12-12.9 N UT NE 109-33-49.3 W 0003757877 UINTAH BASIN ELECTRONIC TELECOMMaeser 03/03/2009 10715.00000 40-27-57.9 N WA NE 119-16-04.2 W 0003758709 Pocketinet Communications Inc. Richland 03/03/2009 17820.00000 46-18-31.9 N PR NE 066-29-34.2 W 0003759050 CCPR SERVICES INC. MANATI 03/03/2009 06610.00000 18-27-21.5 N OR NE 123-25-53.8 W 0003759108 USCOC of Oregon RSA #5, Inc. DILLARD 03/03/2009 06696.25000 43-05-38.4 N WA NE 119-23-26.4 W 0003759474 Verizon Wireless (VAW) LLC Hanford 03/04/2009 10637.50000 46-28-43.3 N WA NE 119-23-26.4 W 0003759474 Verizon Wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289167A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289167A1.txt
  • correction continues beyond the date of publication of this report, as new problems are identified. Reporting companies frequently re-file data, not only for the current reporting period, but also occasionally for previous reporting periods. Hence, users of the quality of service report data may find some inconsistencies with data extracted from the ARMIS database at a later or earlier date. 4.2 Commission Recalculation of Holding Company Aggregate Statistics Commission staff do not typically delete or adjust company-filed data for presentation in the quality of service report, except for recalculating holding company totals and other data aggregates as described in Section 3.1. Recalculated aggregates appear in the tables of the quality of service report. These may not match corresponding company-filed totals and
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289324A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289324A1.txt
  • Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 080-16-41.7 W 0003764662 AA Acquisitions LLC Opa-Locka 03/09/2009 00123.00000 25-54-56.1 N GA NE 085-09-30.8 W 0003764977 Floyd County Airport Commission Rome 03/09/2009 00123.00000 34-20-57.3 N OR NE 122-40-02.3 W 0003767476 Portland Arena Management, LLC Portland 03/11/2009 00123.05000 45-31-57.4 N IN NE 085-05-01.9 W 0003770495 GPI Aviation ANGOLA 03/12/2009 00123.07500 41-38-04.2 N MA NE 070-36-58.1 W 0003770822 COUNTY OF DUKES COUNTY West Tisbury 03/12/2009 00122.95000 41-23-34.4 N FL NE C 0003771801 East Flagler Mosquito Control District 03/13/2009 00129.12500 MO NE 093-13-36.9 W 0003771856 TANEY COUNTY AIRPORT Hollister 03/13/2009 00122.70000 36-37-23.9 N WI NE 089-42-01.5 W 0003772097 HOWARD YOUNG MEDICAL CENTER WOODRUFF 03/13/2009 00123.05000 45-53-04.8 N IA NE 094-10-59.1 W 0003772298 Fort
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289556A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289556A1.txt
  • 118-24-51.2 W 0003779252 American Messaging Services, LLC AVALON 03/19/2009 00931.58750 33-24-20.0 N CA RM KNKG523 119-00-39.3 W 0003779252 American Messaging Services, LLC BAKERSFIELD 03/19/2009 00931.11250 35-22-48.8 N CA RM KNKG523 119-00-39.3 W 0003779252 American Messaging Services, LLC BAKERSFIELD 03/19/2009 00931.58750 35-22-48.8 N CA RM KNKG523 118-49-23.3 W 0003779252 American Messaging Services, LLC BAKERSFIELD 03/19/2009 00931.11250 35-33-08.8 N CA RM KNKG523 117-59-04.2 W 0003779252 American Messaging Services, LLC BALDWIN PARK 03/19/2009 00931.11250 34-03-54.0 N CA RM KNKG523 117-02-25.1 W 0003779252 American Messaging Services, LLC BARSTOW 03/19/2009 00931.11250 34-58-16.9 N CA RM KNKG523 118-07-32.2 W 0003779252 American Messaging Services, LLC BELLFLOWER 03/19/2009 00931.11250 33-54-06.0 N CA RM KNKG523 118-07-32.2 W 0003779252 American Messaging Services, LLC BELLFLOWER 03/19/2009 00931.58750 33-54-06.0 N CA RM KNKG523
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289731A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289731A1.txt
  • N AR NE 091-36-18.5 W 0003786921 CENTERPOINT ENERGY GAS TRANSMSEARCY 03/25/2009 00952.08125 35-12-07.3 N NY NE 074-11-33.9 W 0003787333 Northrop Grumman Information TechnologStaten Island 03/26/2009 21875.00000 40-34-51.9 N NY NE 074-11-33.9 W 0003787333 Northrop Grumman Information TechnologStaten Island 03/26/2009 21975.00000 40-34-51.9 N IA NE P 093-35-48.0 W 0003787877 MidAmerican Energy Company DES MOINES 03/26/2009 00952.41875 41-37-00.0 N IA NE P 094-16-04.2 W 0003788080 MidAmerican Energy Company LINDEN 03/26/2009 00952.41875 41-38-39.0 N KS NE 100-51-53.0 W 0003788545 NORTHERN NATURAL GAS COMPANYSUBLETTE 03/27/2009 00928.33125 37-17-45.0 N KS NE 100-51-53.0 W 0003788545 NORTHERN NATURAL GAS COMPANYSUBLETTE 03/27/2009 00952.33125 37-17-45.0 N DC RM WNTQ477 077-01-18.9 W 0003783313 WASHINGTON CABLE SYSTEMS INC WASHINGTON 03/23/2009 18142.00000 - 18442.00000 38-53-39.4 N HI RM WPOT673 156-14-41.9 W 0003785302 HARMER
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290273A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290273A1.txt
  • Inc. Meeker 04/13/2009 11365.00000 39-58-11.7 N CO NE 107-54-48.2 W 0003805462 XTO Energy, Inc. Meeker 04/13/2009 10875.00000 40-02-13.3 N CA NE P 122-08-35.8 W 0003807178 UNIVERSITY OF CALIFORNIA OFFSHORE 04/14/2009 00956.40625 36-41-46.0 N Page 24 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE P 083-14-04.2 W 0003807194 LEE COUNTY PUBLIC SERVICE AUTHOJONESVILLE 04/14/2009 00956.28125 36-41-35.9 N MT NE P 115-17-24.5 W 0003807201 CITY OF THOMPSON FALLS THOMPSON FALLS 04/14/2009 00956.34375 47-35-17.8 N FL NE 082-44-23.0 W 0003807798 Florida Power Corporation d/b/a Progress Tarpon Springs 04/15/2009 06315.84000 28-08-52.0 N FL NE 082-47-13.3 W 0003807800 Florida Power Corporation d/b/a Progress Holiday 04/15/2009 06063.80000 28-11-03.0 N CA NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290675A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290675A1.txt
  • 084-29-59.0 W 0003831953 QX Networking and Design, Inc. Lexington 05/08/2009 10775.00000 38-02-51.0 N KY NE 084-29-59.0 W 0003831953 QX Networking and Design, Inc. Lexington 05/08/2009 17900.00000 38-02-51.0 N KY NE 084-29-57.0 W 0003831954 QX Networking and Design, Inc. Lexington 05/08/2009 10815.00000 38-02-51.0 N KY NE 084-29-57.0 W 0003831954 QX Networking and Design, Inc. Lexington 05/08/2009 10855.00000 38-02-51.0 N KY NE 084-29-04.2 W 0003831955 QX Networking and Design, Inc. Lexington 05/08/2009 11225.00000 38-05-34.8 N NM NE 104-28-19.8 W 0003832676 Enterprise Products Operating, LLC Whites City 05/08/2009 00928.06875 32-12-31.4 N NM NE 104-28-19.8 W 0003832676 Enterprise Products Operating, LLC Whites City 05/08/2009 00952.06875 32-12-31.4 N RO WNEY528 0003832515 Montana Rail Link Inc 05/08/2009 RO WNEY529 0003832518 Montana Rail Link Inc 05/08/2009 RO WPOT440
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290860A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290860A1.txt
  • Street BTA 262, LLC Bakersfield 05/11/2009 17970.00000 35-17-45.1 N CA NE 119-15-03.3 W 0003833693 Royal Street BTA 262, LLC Bakersfield 05/11/2009 19530.00000 35-23-06.9 N NJ NE 075-00-16.5 W 0003833726 TELECOM TRANSPORT MANAGEMENTCHERRY HILL 05/11/2009 21880.00000 39-52-51.2 N NJ NE 075-01-48.4 W 0003833727 TELECOM TRANSPORT MANAGEMENTMagnolia 05/11/2009 23130.00000 39-51-26.6 N WA NE 119-16-35.8 W 0003833926 Pocketinet Communications, Inc. Richland 05/11/2009 19620.00000 46-17-04.2 N NY NE 073-56-47.8 W 0003834043 AT&T CORP. BROOKLYN 05/11/2009 11425.00000 40-34-49.9 N NY NE 074-00-01.2 W 0003834044 AT&T CORP. BROOKLYN 05/11/2009 11315.00000 40-35-50.9 N Page 14 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR NE 118-36-20.0 W 0003834148 Pocketinet Communications,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291144A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291144A1.txt
  • Inc Texarkana 05/27/2009 00131.55000 33-27-13.4 N AR NE 093-59-27.7 W 0003850365 Aviation Spectrum Resources, Inc Texarkana 05/27/2009 00136.97500 33-27-13.4 N Page 4 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 121-29-15.9 W 0003851427 CALIFORNIA, STATE OF SACRAMENTO 05/28/2009 00122.87500 38-35-56.3 N KY RM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 05/27/2009 00129.47500 39-02-55.8 N KY RM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 05/27/2009 00130.75000 39-02-55.8 N KY RM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 05/27/2009 00131.62500 39-02-55.8 N RO KGY6 0003849330 ELDON, CITY OF 05/26/2009 RO KCC6 0003850092 Aviation Spectrum Resources Inc 05/27/2009 RO KCL8 0003850093 Aviation
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291222A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291222A1.txt
  • M03 J03 N03 M04 J04 N04 M05 J05 N05 M06 J06 N06 M07 J07 N07 M08 J08 N08 Month (March, July, November) Per cent with T elephone In Unit Available Table 2 Telephone Penetration by State (Percentage of Households with Telephone Service) State Alabama 87.9% 94.9% 7.0% * Alaska 83.8 97.2 13.4 * Arizona 88.8 95.4 6.7 Arkansas 88.2 92.4 4.2 California 91.7 96.3 4.6 * Colorado 94.4 97.6 3.2 Connecticut 95.5 97.1 1.6 Delaware 95.0 96.7 1.6 District of Columbia 94.7 90.3 -4.4 Florida 85.5 92.1 6.6 * Georgia 88.9 90.8 2.0 Hawaii 94.6 96.2 1.6 Idaho 89.5 94.8 5.3 * Illinois 95.0 93.9 -1.1 Indiana 90.3 91.5 1.1 Iowa 95.4 97.1 1.7 Kansas 94.9 95.9 1.0 Kentucky 86.9 95.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291391A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291391A2.txt
  • 65.4 2.9 11.0 20.7 Grenada $7,050,009 0.0 35.2 0.0 7.1 57.7 $419,554 0.0 92.6 0.0 0.3 7.1 $41,617 0.0 0.0 0.0 0.0100.0 66,150,339 0.0 56.5 0.0 6.6 36.9 Guadeloupe $1,848,341 0.0 36.9 7.4 21.0 34.7 $8,504 0.0 0.0 0.0 0.0100.0 $1,106,273 0.0 0.0 0.0 0.0100.0 12,157,091 0.0 30.8 6.7 18.5 44.0 Haiti $118,481,728 0.1 23.7 16.3 6.6 53.4 $2,132,789 0.0 4.2 0.0 2.4 93.4 $7,376,926 0.0 0.0 0.0 0.0100.0 658,747,059 0.2 20.9 16.1 7.6 55.3 Jamaica $100,120,441 0.0 26.0 0.6 15.5 57.9 $2,935,923 0.0 43.0 0.0 23.4 33.6 $2,461,616 0.0 0.0 0.0 0.0100.0 964,953,836 0.0 27.7 0.4 16.7 55.2 Montserrat $504,227 0.0 13.6 0.0 47.3 39.0 $197 0.0 0.0 0.0 0.0100.0 $13,479 0.0 0.0 0.0 0.0100.0 3,979,281 0.0 9.5 0.0 68.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291432A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291432A1.txt
  • LLC Pueblo 06/09/2009 11245.00000 38-20-44.5 N CO NE 104-46-57.1 W 0003863147 STELERA WIRELESS, LLC Pueblo 06/09/2009 11325.00000 38-20-44.5 N CO NE 104-33-26.7 W 0003863149 STELERA WIRELESS, LLC PUEBLO 06/09/2009 06093.45000 38-21-27.9 N CO NE 104-33-26.7 W 0003863149 STELERA WIRELESS, LLC PUEBLO 06/09/2009 10715.00000 38-21-27.9 N CO NE 104-52-21.4 W 0003863151 STELERA WIRELESS, LLC Pueblo 06/09/2009 10755.00000 38-21-39.4 N WA NE 119-16-04.2 W 0003863955 Pocketinet Communications, Inc Richland 06/09/2009 17820.00000 46-18-31.9 N IL NE 089-42-04.0 W 0003864179 CyberTel Cellular Telephone Company Highland 06/10/2009 06795.00000 38-45-08.0 N IL NE 089-32-00.0 W 0003864273 CyberTel Cellular Telephone Company BREESE 06/10/2009 06635.00000 38-39-04.8 N CA NE 118-12-07.1 W 0003864357 Los Angeles SMSA Limited Partnership Los Angeles 06/10/2009 18000.00000 34-03-44.6 N NY NE 073-53-47.0 W 0003867216 AT&T
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291566A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291566A1.txt
  • Frequency (MHz) Applicant Name Latitude City TX NE 098-07-30.5 W 0003871996 CLEARWIRE SPECTRUM HOLDINGS IIINew Braunfels 06/15/2009 11095.00000 29-42-24.7 N TX NE 098-07-30.5 W 0003871996 CLEARWIRE SPECTRUM HOLDINGS IIINew Braunfels 06/15/2009 19575.00000 29-42-24.7 N TX NE 098-07-30.5 W 0003871996 CLEARWIRE SPECTRUM HOLDINGS IIINew Braunfels 06/15/2009 19675.00000 29-42-24.7 N TX NE 098-41-41.5 W 0003871997 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/15/2009 17965.00000 29-26-04.2 N TX NE 098-41-41.5 W 0003871997 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/15/2009 18015.00000 29-26-04.2 N TX NE 098-41-41.5 W 0003871997 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/15/2009 18065.00000 29-26-04.2 N TX NE 098-41-41.5 W 0003871997 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/15/2009 18115.00000 29-26-04.2 N TX NE 098-07-13.0 W 0003871998 CLEARWIRE SPECTRUM HOLDINGS IIINEW BRAUNFELS 06/15/2009 17815.00000 29-43-51.0 N TX NE 098-07-13.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291914A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291914A1.txt
  • the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM 122-53-59.0 W 0003838997 City of Healdsburg Healdsburg 06/23/2009 00122.80000 38-39-15.7 N KY AM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 06/30/2009 00129.47500 39-02-55.8 N KY AM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 06/30/2009 00130.75000 39-02-55.8 N KY AM KNB5 084-40-04.2 W 0003850197 Aviation Spectrum Resources Inc Covington 06/30/2009 00131.22500 39-02-55.8 N AR NE 092-28-02.6 W 0003888031 Baxter County Regional Airport AuthorityMidway 06/30/2009 00123.00000 36-22-02.2 N CO NE 106-51-53.7 W 0003889341
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292532A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292532A1.txt
  • Amoco Production Company Painter 07/28/2009 11405.00000 41-18-39.3 N ID NE P 116-14-31.8 W 0003914512 CITY OF GARDEN CITY GARDEN CITY 07/28/2009 00956.38125 43-37-40.1 N Page 37 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY NE P 073-29-27.0 W 0003914551 VILLAGE OF ARGYLE ARGYLE 07/28/2009 00956.39375 43-14-04.2 N WY NE 110-54-22.4 W 0003914584 Amoco Production Company Evanston 07/28/2009 10915.00000 41-21-03.8 N WY NE 110-54-22.4 W 0003914584 Amoco Production Company Evanston 07/28/2009 10955.00000 41-21-03.8 N WY NE 110-54-22.4 W 0003914584 Amoco Production Company Evanston 07/28/2009 11155.00000 41-21-03.8 N OR NE 121-18-10.6 W 0003915104 Bend Cable Communications, LLC BEND, Oregon 07/28/2009 10855.00000 44-05-25.0 N OR NE 121-18-10.6 W 0003915104
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292593A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292593A1.txt
  • 21,793 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 75,939 75,477 75,872 Wyoming United States Total West Virginia Wisconsin * Current dollar equivalents are at the end of Table 4 82 Alabama 6.4 Montana 5.7 Alaska 6.0 Nebraska 6.0 Arizona 6.7 Nevada 4.8 Arkansas 5.5 New Hampshire 4.1 California 2.4 New Jersey 4.5 Colorado 4.4 New Mexico 8.5 Connecticut 4.2 New York 3.3 Delaware 5.2 North Carolina 4.6 District Of Columbia 6.3 North Dakota 5.6 Florida 2.8 Ohio 3.9 Georgia 5.7 Oklahoma 5.5 Hawaii 6.2 Oregon 5.1 Idaho 4.9 Pennsylvania 3.4 Illinois 4.5 Rhode Island 5.0 Indiana 5.9 South Carolina 5.1 Iowa 4.3 South Dakota 4.9 Kansas 4.9 Tennessee 6.3 Kentucky 5.5 Texas 3.1 Louisiana 8.5 Utah 5.4 Maine 4.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292736A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292736A1.txt
  • HOLDINGS IIIMt Holly 08/04/2009 23025.00000 40-00-27.4 N PA NE 075-18-11.3 W 0003920977 CLEARWIRE SPECTRUM HOLDINGS IIICenter Square 08/04/2009 23025.00000 40-10-28.9 N Page 21 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NJ NE 074-54-45.9 W 0003920979 CLEARWIRE SPECTRUM HOLDINGS IIIMarlton 08/04/2009 19325.00000 39-54-31.6 N NJ NE 074-56-04.2 W 0003920980 CLEARWIRE SPECTRUM HOLDINGS IIIMarlton 08/04/2009 19325.00000 39-53-39.8 N PA NE 074-56-21.1 W 0003920981 CLEARWIRE SPECTRUM HOLDINGS IIINEWTOWN 08/04/2009 21825.00000 40-13-58.1 N PA NE 075-18-07.9 W 0003920982 CLEARWIRE SPECTRUM HOLDINGS IIIWHITPAIN TOWNS 08/04/2009 11665.00000 40-09-45.4 N PA NE 075-18-07.9 W 0003920982 CLEARWIRE SPECTRUM HOLDINGS IIIWHITPAIN TOWNS 08/04/2009 21825.00000 40-09-45.4 N PA NE 075-32-17.1 W 0003920983 CLEARWIRE SPECTRUM HOLDINGS IIIEast
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292737A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292737A1.txt
  • the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA NE 084-56-19.9 W 0003925043 Aviation Spectrum Resources, Inc Columbus 08/06/2009 00130.47500 32-30-58.8 N KY NE 084-40-04.2 W 0003925056 Aviation Spectrum Resources, Inc Covington 08/06/2009 00130.87500 39-02-55.8 N MA NE 071-00-23.1 W 0003925060 Aviation Spectrum Resources, Inc Boston 08/06/2009 00131.80000 42-21-46.7 N MD NE 076-40-06.0 W 0003925064 Aviation Spectrum Resources, Inc Baltimore 08/06/2009 00130.77500 39-10-31.0 N IL NE 087-53-01.2 W 0003925074 Aviation Spectrum Resources, Inc Chicago 08/06/2009 00136.97500 41-54-50.1 N IN NE 086-16-29.9 W 0003925078 Aviation Spectrum
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292759A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292759A1.txt
  • New Jersey 94.1 94.8 0.6 New Mexico 85.3 92.3 7.0 New York 90.8 94.7 3.8 * North Carolina 89.3 95.3 6.0 * North Dakota 95.1 98.5 3.4 Ohio 92.2 97.5 5.2 * Oklahoma 91.5 96.0 4.5 Oregon 91.2 98.2 7.0 * Pennsylvania 95.1 97.6 2.5 Rhode Island 93.3 96.0 2.7 South Carolina 81.8 94.6 12.8 * South Dakota 92.7 96.9 4.2 Tennessee 87.6 92.6 5.0 Texas 89.0 94.7 5.7 * Utah 90.3 96.2 6.0 * Vermont 92.7 97.1 4.4 Virginia 93.1 95.4 2.3 Washington 92.5 98.7 6.3 * West Virginia 88.1 94.9 6.8 * Wisconsin 94.8 96.6 1.8 Wyoming 89.7 98.4 8.6 * Total United States 91.4 95.6 4.2 * * Increase is statistically significant at the 95% confidence level. Differences
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292824A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292824A1.txt
  • GREATER MISSOURI, LLCDIXON 08/12/2009 10587.50000 37-53-41.7 N MO NE 090-09-37.1 W 0003931283 USCOC OF GREATER MISSOURI, LLCRocky Ridge 08/12/2009 06655.00000 37-48-54.9 N PR NE 066-07-25.9 W 0003932161 CCPR Services, Inc. Guaynabo 08/13/2009 11692.50000 18-20-08.9 N PR NE 066-09-26.3 W 0003932202 CCPR Services, Inc. Bayamon 08/13/2009 11652.50000 18-20-18.8 N WA NE 124-04-23.1 W 0003932299 Seattle SMSA Limited Partnership Forks 08/13/2009 10577.50000 48-05-04.2 N WI NE 088-47-11.4 W 0003932397 UNITED STATES CELLULAR OPERATINOMRO 08/13/2009 06855.00000 43-59-14.4 N PA NE 079-53-52.5 W 0003932524 FiberTower Network Services Corp. Pittsburgh 08/13/2009 19380.00000 40-27-06.9 N PA NE 080-02-36.6 W 0003932528 FiberTower Network Services Corp. Mt. Lebanon 08/13/2009 10557.50000 40-23-00.0 N WY NE 106-33-12.9 W 0003932635 Union Telephone Company Casper 08/13/2009 10562.50000 42-44-15.8 N CA NE 121-08-09.2 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293005A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293005A1.txt
  • W 0003939783 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 11585.00000 39-16-48.7 N MD NE 076-32-48.1 W 0003939783 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 21925.00000 39-16-48.7 N MD NE 076-32-48.1 W 0003939783 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 22025.00000 39-16-48.7 N MD NE 076-27-24.1 W 0003939784 CLEARWIRE SPECTRUM HOLDINGS IIIEdgemere 08/19/2009 19375.00000 39-14-23.3 N MD NE 076-29-40.9 W 0003939785 CLEARWIRE SPECTRUM HOLDINGS IIIRosedale 08/19/2009 19425.00000 39-20-04.2 N MD NE 076-41-10.0 W 0003939786 CLEARWIRE SPECTRUM HOLDINGS IIIHalethorpe 08/19/2009 21875.00000 39-13-49.1 N MD NE 076-43-35.4 W 0003939787 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 11585.00000 39-17-22.9 N MD NE 076-43-35.4 W 0003939787 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 11665.00000 39-17-22.9 N MD NE 076-43-35.4 W 0003939787 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 17965.00000 39-17-22.9 N MD NE 076-43-35.4 W 0003939787 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293006A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293006A1.txt
  • 0003941258 CLEARWIRE SPECTRUM HOLDINGS IIIPHILADELPHIA 08/20/2009 21975.00000 39-57-19.4 N PA NE 075-11-48.2 W 0003941258 CLEARWIRE SPECTRUM HOLDINGS IIIPHILADELPHIA 08/20/2009 22025.00000 39-57-19.4 N PA NE 074-59-54.0 W 0003941259 CLEARWIRE SPECTRUM HOLDINGS IIIPHILADELPHIA 08/20/2009 23025.00000 40-04-58.5 N NJ NE 075-01-18.5 W 0003941260 CLEARWIRE SPECTRUM HOLDINGS IIIPalmyra 08/20/2009 19325.00000 40-00-11.5 N PA NE 075-35-28.3 W 0003941261 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 08/20/2009 10735.00000 39-58-04.2 N PA NE 075-35-28.3 W 0003941261 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 08/20/2009 10815.00000 39-58-04.2 N PA NE 075-35-28.3 W 0003941261 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 08/20/2009 11095.00000 39-58-04.2 N PA NE 075-35-28.3 W 0003941261 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 08/20/2009 11175.00000 39-58-04.2 N PA NE 075-35-28.3 W 0003941261 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 08/20/2009 19325.00000 39-58-04.2 N PA NE 075-35-28.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293258A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293258A2.txt
  • 137 0.9 144 0.9 392 2.6 215 1.4 6,659 43.7 15,225 Pennsylvania 27,825 47.9 482 0.8 719 1.2 1,503 2.6 403 0.7 27,213 46.8 58,145 Puerto Rico 4,583 58.8 18 0.2 77 1.0 208 2.7 80 1.0 2,833 36.3 7,801 Rhode Island 3,081 59.1 27 0.5 58 1.1 114 2.2 25 0.5 1,909 36.6 5,214 South Carolina 8,561 48.4 746 4.2 103 0.6 591 3.3 314 1.8 7,371 41.7 17,687 South Dakota 1,349 23.1 34 0.6 15 0.3 84 1.4 48 0.8 4,304 73.8 5,835 Tennessee 12,517 48.2 791 3.0 132 0.5 881 3.4 301 1.2 11,350 43.7 25,971 Texas 50,054 45.7 2,321 2.1 717 0.7 3,009 2.7 2,143 2.0 51,276 46.8 109,520 Utah 6,344 57.0 61 0.6 67 0.6 248
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293261A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293261A2.txt
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by incumbent LECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293451A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293451A1.txt
  • 06605.00000 41-07-20.0 N IA MD KAC76 094-38-42.0 W 0003959689 MID AMERICAN ENERGY COMPANY ADAIR 09/09/2009 06226.89000 41-32-01.0 N IA MD KAC76 094-38-42.0 W 0003959689 MID AMERICAN ENERGY COMPANY ADAIR 09/09/2009 06286.19000 41-32-01.0 N IA MD KAC76 094-38-42.0 W 0003959689 MID AMERICAN ENERGY COMPANY ADAIR 09/09/2009 06315.84000 41-32-01.0 N WY MD WQJH557 104-46-19.5 W 0003960430 Millhouse Electronics Inc Cheyenne 09/09/2009 21825.00000 41-10-04.2 N OR MD WQHR256 122-41-44.4 W 0003960722 CLEARWIRE SPECTRUM HOLDINGS II PORTLAND 09/10/2009 18015.00000 45-29-19.4 N OH MD KQL63 083-17-29.6 W 0003960734 Columbia Gas Transmission CorporationMOUNT STERLING 09/10/2009 06825.00000 39-43-50.2 N OH MD KQL63 083-17-29.6 W 0003960734 Columbia Gas Transmission CorporationMOUNT STERLING 09/10/2009 06855.00000 39-43-50.2 N OH MD KQL64 083-05-31.8 W 0003960744 Columbia Gas Transmission CorporationGROVE CITY 09/10/2009 06625.00000 39-54-04.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293594A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293594A1.txt
  • IIIBURLINGTON 09/15/2009 23075.00000 40-04-39.0 N PA NE 075-23-52.1 W 0003965637 CLEARWIRE SPECTRUM HOLDINGS IIIChester 09/15/2009 19375.00000 39-49-57.7 N PA NE 075-23-52.1 W 0003965637 CLEARWIRE SPECTRUM HOLDINGS IIIChester 09/15/2009 19475.00000 39-49-57.7 N PA NE 075-18-17.7 W 0003965638 CLEARWIRE SPECTRUM HOLDINGS IIIUpper Darby 09/15/2009 23275.00000 39-57-48.6 N PA NE 075-09-24.1 W 0003965640 CLEARWIRE SPECTRUM HOLDINGS IIIPhiladelphia 09/15/2009 23275.00000 39-56-56.2 N PA NE 075-11-04.2 W 0003965641 CLEARWIRE SPECTRUM HOLDINGS IIIPHILADELPHIA 09/15/2009 21825.00000 39-57-14.2 N PA NE 075-09-53.8 W 0003965642 CLEARWIRE SPECTRUM HOLDINGS IIIPhiladelphia 09/15/2009 23125.00000 39-56-54.2 N PA NE 075-23-40.2 W 0003965646 CLEARWIRE SPECTRUM HOLDINGS IIITrooper 09/15/2009 21875.00000 40-09-11.2 N PA NE 075-24-22.7 W 0003965647 CLEARWIRE SPECTRUM HOLDINGS IIIBROOKHAVEN 09/15/2009 22025.00000 39-52-38.4 N PA NE 075-00-37.4 W 0003965648 CLEARWIRE SPECTRUM HOLDINGS IIIPhiladelphia 09/15/2009 21825.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293752A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293752A1.txt
  • IIIDurham 09/22/2009 17965.00000 35-58-35.9 N NC NE 078-48-12.0 W 0003971642 CLEARWIRE SPECTRUM HOLDINGS IIICary 09/22/2009 17865.00000 35-43-50.5 N NC NE 078-48-12.0 W 0003971642 CLEARWIRE SPECTRUM HOLDINGS IIICary 09/22/2009 23025.00000 35-43-50.5 N NC NE 079-05-29.3 W 0003971643 CLEARWIRE SPECTRUM HOLDINGS IIICHAPEL HILL 09/22/2009 23175.00000 35-56-54.7 N NC NE 078-37-13.5 W 0003971644 CLEARWIRE SPECTRUM HOLDINGS IIIRaleigh 09/22/2009 21975.00000 35-51-49.4 N NC NE 080-35-04.2 W 0003971645 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 09/22/2009 11225.00000 35-01-43.1 N NC NE 080-35-04.2 W 0003971645 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 09/22/2009 11265.00000 35-01-43.1 N NC NE 080-35-04.2 W 0003971645 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 09/22/2009 11345.00000 35-01-43.1 N NC NE 080-35-04.2 W 0003971645 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 09/22/2009 11505.00000 35-01-43.1 N NC NE 080-35-04.2 W 0003971645 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 09/22/2009 11585.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293864A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293864A1.txt
  • 0003979956 CLEARWIRE SPECTRUM HOLDINGS IIIGENEVA 09/28/2009 17965.00000 41-52-52.1 N IL NE 088-19-49.3 W 0003979956 CLEARWIRE SPECTRUM HOLDINGS IIIGENEVA 09/28/2009 18065.00000 41-52-52.1 N IL NE 088-19-49.3 W 0003979956 CLEARWIRE SPECTRUM HOLDINGS IIIGENEVA 09/28/2009 21825.00000 41-52-52.1 N IL NE 088-19-49.3 W 0003979956 CLEARWIRE SPECTRUM HOLDINGS IIIGENEVA 09/28/2009 21975.00000 41-52-52.1 N IL NE 087-58-03.2 W 0003979957 CLEARWIRE SPECTRUM HOLDINGS IIIBuffalo Grove 09/28/2009 23075.00000 42-10-04.2 N IL NE 088-04-51.7 W 0003979958 CLEARWIRE SPECTRUM HOLDINGS IIILisle 09/28/2009 19325.00000 41-46-21.2 N IL NE 087-45-28.7 W 0003979959 CLEARWIRE SPECTRUM HOLDINGS IIIChicago 09/28/2009 21875.00000 41-57-43.2 N IL NE 087-55-54.6 W 0003979960 CLEARWIRE SPECTRUM HOLDINGS IIIWheeling 09/28/2009 22025.00000 42-08-31.7 N IL NE 087-33-41.2 W 0003979961 CLEARWIRE SPECTRUM HOLDINGS IIIChicago 09/28/2009 23025.00000 41-44-41.0 N IL NE 087-33-41.2 W 0003979961 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293960A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293960A1.txt
  • Latitude City NY AM WLJ930 073-53-19.5 W 0003950296 REGENT BROADCASTING OF ALBANY,Schenectady 10/07/2009 00944.87500 42-44-12.8 N NY AM WLJ930 073-53-19.5 W 0003950296 REGENT BROADCASTING OF ALBANY,Schenectady 10/07/2009 00947.00000 42-44-12.8 N AZ AM 112-07-04.6 W 0003988321 GRAND CANYON BROADCASTERS, INCPRESCOTT 10/07/2009 00946.00000 34-41-15.1 N FL MD WLI260 080-12-11.9 W 0003987356 WPOW LICENSE LIMITED PARTNERSHMiami 10/05/2009 00945.50000 25-56-42.6 N CA MD WGI245 124-12-04.2 W 0003987593 BICOASTAL MEDIA LICENSES II, LLC EUREKA 10/05/2009 00950.50000 40-44-31.4 N AZ MD WDD710 112-04-27.8 W 0003988365 CBS RADIO STATIONS INC. PHOENIX 10/06/2009 00949.50000 33-30-28.6 N NV MD WPUY947 119-09-49.3 W 0003988426 DONEGAL ENTERPRISES Yerington 10/06/2009 00946.00000 38-59-16.3 N IN MD WLJ593 086-08-07.6 W 0003989864 UNIVERSITY OF INDIANAPOLIS Indianapolis 10/07/2009 00950.00000 39-42-31.8 N IN MD WLJ793 086-10-14.0 W 0003989930
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294114A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294114A1.txt
  • 11385.00000 37-23-13.0 N CA MD WQFY914 122-08-33.0 W 0003994625 Wiline Networks Inc Cupertino 10/13/2009 10895.00000 37-19-13.0 N CA MD WQGG371 122-24-04.1 W 0003994629 Wiline Networks Inc San Francisco 10/13/2009 21225.00000 37-47-24.0 N WA MD WPNB554 124-18-22.8 W 0003994720 Seattle SMSA Limited Partnership SAPPHO 10/13/2009 10642.50000 48-07-47.3 N WA MD WQKV855 124-04-23.1 W 0003994726 Seattle SMSA Limited Partnership Forks 10/13/2009 10577.50000 48-05-04.2 N MI MD KOB50 085-32-39.3 W 0003995059 ISLAND TELEPHONE COMPANY St. James 10/13/2009 05945.20000 45-42-09.9 N MI MD KOB50 085-32-39.3 W 0003995059 ISLAND TELEPHONE COMPANY St. James 10/13/2009 06004.50000 45-42-09.9 N MI MD KOB50 085-32-39.3 W 0003995059 ISLAND TELEPHONE COMPANY St. James 10/13/2009 06063.80000 45-42-09.9 N MI MD KOB50 085-32-39.3 W 0003995059 ISLAND TELEPHONE COMPANY St. James 10/13/2009 06123.10000 45-42-09.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294277A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294277A1.txt
  • HOLDINGS IIIDallas 10/21/2009 18065.00000 32-44-31.2 N TX NE 096-41-02.0 W 0004003876 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 10/21/2009 21825.00000 32-44-31.2 N TX NE 096-41-02.0 W 0004003876 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 10/21/2009 21925.00000 32-44-31.2 N TX NE 096-41-02.0 W 0004003876 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 10/21/2009 22125.00000 32-44-31.2 N TX NE 096-41-02.0 W 0004003876 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 10/21/2009 22225.00000 32-44-31.2 N TX NE 096-43-04.2 W 0004003877 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 10/21/2009 10775.00000 33-02-31.2 N TX NE 096-43-04.2 W 0004003877 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 10/21/2009 10895.00000 33-02-31.2 N TX NE 096-43-04.2 W 0004003877 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 10/21/2009 11055.00000 33-02-31.2 N TX NE 096-43-04.2 W 0004003877 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 10/21/2009 17815.00000 33-02-31.2 N TX NE 096-43-04.2 W 0004003877 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 10/21/2009 17915.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294278A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294278A1.txt
  • 32-44-55.6 N TX NE 097-10-45.8 W 0004004121 CLEARWIRE SPECTRUM HOLDINGS IIIFT. WORTH 10/21/2009 19525.00000 32-44-55.6 N TX NE 097-10-45.8 W 0004004121 CLEARWIRE SPECTRUM HOLDINGS IIIFT. WORTH 10/21/2009 19575.00000 32-44-55.6 N TX NE 097-10-45.8 W 0004004121 CLEARWIRE SPECTRUM HOLDINGS IIIFT. WORTH 10/21/2009 19625.00000 32-44-55.6 N TX NE 097-10-45.8 W 0004004121 CLEARWIRE SPECTRUM HOLDINGS IIIFT. WORTH 10/21/2009 19675.00000 32-44-55.6 N TX NE 097-07-04.2 W 0004004122 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 10/21/2009 17815.00000 32-36-16.1 N TX NE 097-07-04.2 W 0004004122 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 10/21/2009 17915.00000 32-36-16.1 N TX NE 097-07-04.2 W 0004004122 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 10/21/2009 17965.00000 32-36-16.1 N TX NE 097-07-04.2 W 0004004122 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 10/21/2009 18065.00000 32-36-16.1 N TX NE 097-07-04.2 W 0004004122 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 10/21/2009 23025.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294281A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294281A1.txt
  • 0004006656 Los Angeles SMSA Limited Partnership DIAMOND BAR 10/23/2009 11405.00000 33-58-57.1 N CA MD WLN847 117-50-26.9 W 0004006656 Los Angeles SMSA Limited Partnership DIAMOND BAR 10/23/2009 18050.00000 33-58-57.1 N Page 1 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPOR717 118-00-04.2 W 0004006658 LOS ANGELES SMSA LIMITED PARTNEWESTMINSTER 10/23/2009 10995.00000 33-44-46.0 N CA MD WPOR717 118-00-04.2 W 0004006658 LOS ANGELES SMSA LIMITED PARTNEWESTMINSTER 10/23/2009 18040.00000 33-44-46.0 N CA MD WPRT712 118-05-27.2 W 0004006659 Los Angeles SMSA Limited Partnership PICO RIVERA 10/23/2009 10755.00000 34-00-02.0 N CA MD WPRT712 118-05-27.2 W 0004006659 Los Angeles SMSA Limited Partnership PICO RIVERA 10/23/2009 19490.00000 34-00-02.0 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294459A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294459A1.txt
  • Limited Partnership SUNLAND 10/23/2009 11325.00000 34-15-39.0 N CA MD WMR876 118-19-35.2 W 0004006936 Los Angeles SMSA Limited Partnership SUNLAND 10/23/2009 11565.00000 34-15-39.0 N CA MD WQII540 118-00-18.2 W 0004006938 Los Angeles SMSA Limited Partnership Baldwin Park 10/23/2009 19575.00000 34-03-27.9 N CA MD WQII540 118-00-18.2 W 0004006938 Los Angeles SMSA Limited Partnership Baldwin Park 10/23/2009 19650.00000 34-03-27.9 N CA MD WPRW841 117-57-04.2 W 0004006939 Los Angeles SMSA Limited Partnership BALDWIN PARK 10/23/2009 10627.50000 34-06-17.0 N CA MD WPRW841 117-57-04.2 W 0004006939 Los Angeles SMSA Limited Partnership BALDWIN PARK 10/23/2009 10995.00000 34-06-17.0 N CA MD WPJE858 117-57-39.2 W 0004006941 Los Angeles SMSA Limited Partnership FULLERTON 10/23/2009 11365.00000 33-52-07.0 N CA MD WPJE858 117-57-39.2 W 0004006941 Los Angeles SMSA Limited Partnership FULLERTON 10/23/2009 17960.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294599A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294599A1.txt
  • 0004020679 CLEARWIRE SPECTRUM HOLDINGS IIIChapel Oaks 11/03/2009 23475.00000 38-54-18.0 N MD NE 076-53-38.6 W 0004020680 CLEARWIRE SPECTRUM HOLDINGS IIICLINTON 11/03/2009 21875.00000 38-46-50.5 N MD NE 076-53-38.6 W 0004020680 CLEARWIRE SPECTRUM HOLDINGS IIICLINTON 11/03/2009 21975.00000 38-46-50.5 N MD NE 076-55-57.3 W 0004020681 CLEARWIRE SPECTRUM HOLDINGS IIISUITLAND 11/03/2009 21875.00000 38-51-11.0 N MD NE 076-58-21.4 W 0004020682 CLEARWIRE SPECTRUM HOLDINGS IIIAdelphi 11/03/2009 23025.00000 38-59-04.2 N VA NE 077-21-41.9 W 0004020683 CLEARWIRE SPECTRUM HOLDINGS IIIReston 11/03/2009 21825.00000 38-58-43.5 N MD NE 076-54-08.5 W 0004020684 CLEARWIRE SPECTRUM HOLDINGS IIIRIVERDALE 11/03/2009 21875.00000 38-57-49.3 N MD NE 076-59-06.7 W 0004020685 CLEARWIRE SPECTRUM HOLDINGS IIIHyattsville 11/03/2009 23025.00000 38-59-35.2 N MD NE 076-54-18.4 W 0004020686 CLEARWIRE SPECTRUM HOLDINGS IIISEAT PLEASANT 11/03/2009 23025.00000 38-53-19.1 N DC NE 076-59-26.2 W 0004020688 CLEARWIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294681A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294681A1.txt
  • NV MD KYL30 118-51-38.5 W 0004028991 CITY OF LOS ANGELES DEPARTMENT HAWTHORNE 11/10/2009 06635.00000 38-16-37.7 N NV MD KYL30 118-51-38.5 W 0004028991 CITY OF LOS ANGELES DEPARTMENT HAWTHORNE 11/10/2009 06745.00000 38-16-37.7 N NV MD KYL30 118-51-38.5 W 0004028991 CITY OF LOS ANGELES DEPARTMENT HAWTHORNE 11/10/2009 06815.00000 38-16-37.7 N WY MD WQJH557 104-46-19.5 W 0004028999 Millhouse Electronics Inc Cheyenne 11/10/2009 21825.00000 41-10-04.2 N CO MD WQHY811 107-53-31.4 W 0004029030 Brainstorm Internet Durango 11/10/2009 21925.00000 37-15-45.6 N IL MD WQKQ949 087-50-03.9 W 0004029249 CLEARWIRE SPECTRUM HOLDINGS IIIOak Lawn 11/12/2009 10775.00000 41-43-07.8 N IL MD WQKQ949 087-50-03.9 W 0004029249 CLEARWIRE SPECTRUM HOLDINGS IIIOak Lawn 11/12/2009 10855.00000 41-43-07.8 N IL MD WQKQ949 087-50-03.9 W 0004029249 CLEARWIRE SPECTRUM HOLDINGS IIIOak Lawn 11/12/2009 19375.00000 41-43-07.8 N Page
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294685A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294685A1.txt
  • Las Cruces 11/13/2009 06063.80000 32-17-33.2 N NM NE 106-41-52.9 W 0004031691 Dona Ana County Las Cruces 11/13/2009 10755.00000 32-17-33.2 N NM NE 106-35-50.4 W 0004031695 Dona Ana County El Paso 11/13/2009 06226.89000 32-01-30.0 N NM NE 106-35-50.4 W 0004031695 Dona Ana County El Paso 11/13/2009 06256.54000 32-01-30.0 N NM NE 106-37-17.8 W 0004031698 Dona Ana County El Paso 11/13/2009 05974.85000 31-49-04.2 N NM NE 107-03-53.0 W 0004031702 Dona Ana County Rincon 11/13/2009 06315.84000 32-41-36.4 N NM NE 106-46-39.9 W 0004031706 Dona Ana County Las Cruces 11/13/2009 11245.00000 32-18-22.5 N IL NE 087-42-19.1 W 0004031727 Village of Olympia Fields Olympia Fields 11/13/2009 23070.00000 41-31-22.7 N IL NE 087-42-19.1 W 0004031727 Village of Olympia Fields Olympia Fields 11/13/2009 23170.00000 41-31-22.7 N IL NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294833A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294833A1.txt
  • N NY MD WQKJ847 073-50-38.9 W 0004038627 Northrop Grumman Information TechnologQueens 11/19/2009 21925.00000 40-47-06.2 N NY MD WQKJ847 073-50-38.9 W 0004038627 Northrop Grumman Information TechnologQueens 11/19/2009 23025.00000 40-47-06.2 N NY MD WQKJ848 073-47-25.5 W 0004038633 Northrop Grumman Information TechnologQueens 11/19/2009 21825.00000 40-46-09.1 N NY MD WQKJ848 073-47-25.5 W 0004038633 Northrop Grumman Information TechnologQueens 11/19/2009 21975.00000 40-46-09.1 N NY MD WQKJ849 073-48-04.2 W 0004038871 Northrop Grumman Information TechnologQueens 11/19/2009 21825.00000 40-45-44.9 N NY MD WQKJ849 073-48-04.2 W 0004038871 Northrop Grumman Information TechnologQueens 11/19/2009 21875.00000 40-45-44.9 N NY MD WQKJ852 073-51-48.6 W 0004038986 Northrop Grumman Information TechnologBrooklyn 11/19/2009 23075.00000 40-40-07.7 N NY MD WQKJ852 073-51-48.6 W 0004038986 Northrop Grumman Information TechnologBrooklyn 11/19/2009 23175.00000 40-40-07.7 N NY MD WQKJ854 073-54-12.2 W 0004038988 Northrop Grumman
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294928A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294928A1.txt
  • W 0004045679 CLEARWIRE SPECTRUM HOLDINGS IIIHOUSTON 11/25/2009 11505.00000 29-49-49.4 N TX NE 095-34-13.4 W 0004045679 CLEARWIRE SPECTRUM HOLDINGS IIIHOUSTON 11/25/2009 11585.00000 29-49-49.4 N TX NE 095-34-13.4 W 0004045679 CLEARWIRE SPECTRUM HOLDINGS IIIHOUSTON 11/25/2009 19375.00000 29-49-49.4 N TX NE 095-34-13.4 W 0004045679 CLEARWIRE SPECTRUM HOLDINGS IIIHOUSTON 11/25/2009 19475.00000 29-49-49.4 N TX NE 095-36-24.0 W 0004045681 CLEARWIRE SPECTRUM HOLDINGS IIITomball 11/25/2009 23075.00000 29-56-04.2 N TX NE 095-38-38.3 W 0004045682 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 11/25/2009 23275.00000 29-50-25.8 N TX NE 095-26-54.3 W 0004045683 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 11/25/2009 23275.00000 29-43-42.3 N TX NE 095-34-10.6 W 0004045685 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 11/25/2009 11305.00000 29-51-08.8 N Page 41 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295089A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295089A1.txt
  • 02025.00000 - 02025.50000 32-17-55.0 N MS MD KT9338 P 090-11-00.0 W 0004048754 MEDIA GENERAL COMMUNICATIONS HJACKSON 11/30/2009 02059.00000 - 02076.00000 32-17-55.0 N MS MD KT9338 P 090-11-00.0 W 0004048754 MEDIA GENERAL COMMUNICATIONS HJACKSON 11/30/2009 02073.50000 - 02085.50000 32-17-55.0 N MS MD KT9338 P 090-11-00.0 W 0004048754 MEDIA GENERAL COMMUNICATIONS HJACKSON 11/30/2009 02109.50000 - 02110.00000 32-17-55.0 N WV MD KB55372 P 080-43-04.2 W 0004050135 WEST VIRGINIA MEDIA HOLDINGS, LLCWHEELING 12/01/2009 02008.00000 - 02110.00000 40-03-51.2 N WV MD KB55372 P 080-43-04.2 W 0004050135 WEST VIRGINIA MEDIA HOLDINGS, LLCWHEELING 12/01/2009 02025.00000 - 02025.50000 40-03-51.2 N WV MD KB55372 P 080-43-04.2 W 0004050135 WEST VIRGINIA MEDIA HOLDINGS, LLCWHEELING 12/01/2009 02025.50000 - 02109.50000 40-03-51.2 N WV MD KB55372 P 080-43-04.2 W 0004050135 WEST VIRGINIA MEDIA HOLDINGS,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295251A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295251A1.txt
  • PR NE 066-00-42.9 W 0004056500 AT&T Mobility Puerto Rico Inc. San Juan 12/08/2009 10785.00000 18-24-19.0 N PR NE 066-00-42.9 W 0004056500 AT&T Mobility Puerto Rico Inc. San Juan 12/08/2009 11632.50000 18-24-19.0 N PR NE 066-02-40.0 W 0004056511 AT&T Mobility Puerto Rico Inc. San Juan 12/08/2009 11142.50000 18-26-05.0 N CA NE 117-14-10.5 W 0004058018 T-MOBILE LICENSE LLC Moreno Valley 12/09/2009 19405.00000 33-54-04.2 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 117-15-04.6 W 0004058019 T-MOBILE LICENSE LLC Moreno Valley 12/09/2009 17845.00000 33-54-42.0 N AK NE 149-36-38.4 W 0004058080 GCI Communication Corp Wasilla 12/08/2009 19645.00000 61-32-07.6 N CA NE 123-05-52.5 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295336A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295336A1.txt
  • 0004064818 Neptuno Media SAN JUAN 12/16/2009 19425.00000 18-23-49.8 N OK NE 098-25-20.1 W 0004065248 Choice Wireless, LC COMANCHE 12/16/2009 05974.85000 34-18-14.2 N AZ NE 111-49-36.1 W 0004065471 SPARKPLUG SOUTHWEST, LLC GILBERT 12/16/2009 19325.00000 33-21-18.8 N AZ NE 111-53-19.7 W 0004065475 SPARKPLUG SOUTHWEST, LLC SCOTTSDALE 12/16/2009 19525.00000 33-30-50.6 N CA NE 117-14-10.5 W 0004065612 T-MOBILE LICENSE LLC Moreno Valley 12/16/2009 19405.00000 33-54-04.2 N CA NE 117-15-04.6 W 0004065613 T-MOBILE LICENSE LLC Moreno Valley 12/16/2009 17845.00000 33-54-42.0 N AZ NE 109-13-29.3 W 0004065956 Verizon Wireless (VAW) LLC-Southwest RSanders 12/16/2009 06034.15000 34-54-26.2 N Page 4 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ NE 109-37-41.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295377A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295377A1.txt
  • correction continues beyond the date of publication of this report, as new problems are identified. Reporting companies frequently re-file data, not only for the current reporting period, but also occasionally for previous reporting periods. Hence, users of the quality of service report data may find some inconsistencies with data extracted from the ARMIS database at a later or earlier date. 4.2 Commission Recalculation of Holding Company Aggregate Statistics Commission staff do not typically delete or adjust company-filed data for presentation in the tables and charts of the quality of service report, except for recalculating holding company totals and other data aggregates as described in Section 3.1. Recalculated aggregates appear in the tables of the quality of service report. These may not
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A1.txt
  • Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ...................................... Table 3.8 Safety Valve Support Payments by Study Area ........................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type ..... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State .......... Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type ............................. Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A2.txt
  • Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ...................................... Table 3.8 Safety Valve Support Payments by Study Area ........................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type ..... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State .......... Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type ............................. Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A3.txt
  • generally reported special access revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. Through 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. Note: Detail may not add to totals due
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A6.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A6.txt
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for Funding Years 2006, 2007 and 2008. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A9.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A9.txt
  • Price Index -20 -10 0 10 20 1980 1982 1984 1986 1988 1990 1992 1994 1996 1998 2000 2002 2004 2006 2008 Percen t Ch ang e fr om Prio r Year CPI All Items CPI Telephone Services 7 - 6 1980 7.0 7.1 3.4 5.5 -0.6 2.3 1981 12.6 15.6 14.6 15.9 6.2 8.0 1982 10.8 9.0 2.7 3.9 4.2 1.7 1983 3.1 0.2 1.4 0.0 7.4 3.9 1984 17.2 10.4 -4.3 -5.1 3.6 3.8 1985 8.9 12.4 -3.7 -3.0 0.6 2.1 1986 7.1 8.9 -9.4 -10.0 0.3 -3.5 1987 3.3 2.6 -12.4 -11.8 -3.0 -3.0 1988 4.5 4.6 -4.2 -2.1 -4.2 -3.8 1989 0.6 1.9 -1.3 -1.7 -2.6 0.5 1990 1.0 1.5 -3.7 -0.1 -2.2 -2.2 1991 5.1 2.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295618A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295618A1.txt
  • Name Latitude City NY MD WPYS573 076-25-47.9 W 0004085645 SAGA COMMUNICATIONS OF NEW ENGIthaca 01/07/2010 00950.50000 42-28-28.2 N NY MD WPYS574 076-25-47.9 W 0004085836 SAGA COMMUNICATIONS OF NEW ENGIthaca 01/07/2010 00945.50000 42-28-28.2 N IN MD WLP831 085-39-56.8 W 0004086016 ANDERSON UNIVERSITY, INC. ANDERSON 01/07/2010 00945.50000 40-06-36.7 N FL MD WJN21 081-51-18.3 W 0004086805 MERIDIAN BROADCASTING, INC. Ft. Myers 01/08/2010 00949.00000 26-39-04.2 N MI NE 083-25-09.2 W 0004085837 AMFM RADIO LICENSES, L.L.C. DETROIT 01/07/2010 00951.00000 42-29-46.2 N NY NE 076-25-47.9 W 0004085875 SAGA COMMUNICATIONS OF NEW ENGIthaca 01/07/2010 00951.50000 42-28-28.2 N WA NE 119-09-21.0 W 0004086780 JACOBS RADIO PROGRAMMING, LLCKENNEWICK 01/08/2010 00946.00000 46-09-43.2 N Page 1 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295623A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295623A1.txt
  • 092-28-42.6 W 0004082426 ARKANSAS, STATE OF GOLD CREEK 01/05/2010 06256.54000 35-00-28.3 N AR MD WNTA880 092-28-42.6 W 0004082426 ARKANSAS, STATE OF GOLD CREEK 01/05/2010 06315.84000 35-00-28.3 N AR MD WNTA880 092-28-42.6 W 0004082426 ARKANSAS, STATE OF GOLD CREEK 01/05/2010 06345.49000 35-00-28.3 N AR MD WNTA880 092-28-42.6 W 0004082426 ARKANSAS, STATE OF GOLD CREEK 01/05/2010 06404.79000 35-00-28.3 N AR MD WNEQ913 092-30-04.2 W 0004082428 ARKANSAS, STATE OF LITTLE ROCK 01/05/2010 05945.20000 34-48-03.6 N Page 4 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR MD WNEQ913 092-30-04.2 W 0004082428 ARKANSAS, STATE OF LITTLE ROCK 01/05/2010 05974.85000 34-48-03.6 N AR MD WNEQ913 092-30-04.2 W 0004082428 ARKANSAS, STATE OF
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295777A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295777A1.txt
  • W 0004088362 CLEARWIRE SPECTRUM HOLDINGS IIICarson 01/11/2010 18015.00000 33-49-59.7 N CA NE 118-15-32.5 W 0004088362 CLEARWIRE SPECTRUM HOLDINGS IIICarson 01/11/2010 18115.00000 33-49-59.7 N CA NE 118-05-34.6 W 0004088363 CLEARWIRE SPECTRUM HOLDINGS IIICerritos 01/11/2010 19575.00000 33-51-35.7 N CA NE 118-05-34.6 W 0004088363 CLEARWIRE SPECTRUM HOLDINGS IIICerritos 01/11/2010 19675.00000 33-51-35.7 N CA NE 118-13-32.2 W 0004088364 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/11/2010 21875.00000 33-56-04.2 N CA NE 118-13-32.2 W 0004088364 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/11/2010 22025.00000 33-56-04.2 N CA NE 118-11-24.8 W 0004088365 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/11/2010 23075.00000 33-55-16.5 N CA NE 118-11-24.8 W 0004088365 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/11/2010 23225.00000 33-55-16.5 N CA NE 118-11-22.2 W 0004088366 CLEARWIRE SPECTRUM HOLDINGS IIICompton 01/11/2010 21825.00000 33-53-03.6 N CA NE 118-11-22.2 W 0004088366 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295778A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295778A1.txt
  • 0004089161 CLEARWIRE SPECTRUM HOLDINGS IIITarzana 01/11/2010 19575.00000 34-10-21.1 N CA NE 118-32-04.9 W 0004089161 CLEARWIRE SPECTRUM HOLDINGS IIITarzana 01/11/2010 19675.00000 34-10-21.1 N CA NE 118-32-04.9 W 0004089161 CLEARWIRE SPECTRUM HOLDINGS IIITarzana 01/11/2010 21875.00000 34-10-21.1 N CA NE 118-32-04.9 W 0004089161 CLEARWIRE SPECTRUM HOLDINGS IIITarzana 01/11/2010 22025.00000 34-10-21.1 N CA NE 118-09-43.0 W 0004089162 CLEARWIRE SPECTRUM HOLDINGS IIIMonterey Park 01/11/2010 19375.00000 34-03-04.2 N CA NE 118-09-43.0 W 0004089162 CLEARWIRE SPECTRUM HOLDINGS IIIMonterey Park 01/11/2010 19475.00000 34-03-04.2 N CA NE 118-09-43.0 W 0004089162 CLEARWIRE SPECTRUM HOLDINGS IIIMonterey Park 01/11/2010 19575.00000 34-03-04.2 N Page 32 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 118-09-43.0 W 0004089162 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295961A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295961A1.txt
  • 01/20/2010 06345.49000 38-13-50.2 N OH NE 082-49-57.6 W 0004098131 TEXAS EASTERN COMMUNICATIONS IWHEELERSBURG 01/21/2010 05974.85000 38-42-08.2 N TX NE 096-33-49.3 W 0004098239 TierOne Converged Networks, Inc. Rose Hill 01/21/2010 11055.00000 32-50-36.5 N TX NE 096-33-49.3 W 0004098239 TierOne Converged Networks, Inc. Rose Hill 01/21/2010 11625.00000 32-50-36.5 N TX NE 096-12-17.2 W 0004098300 TierOne Converged Networks, Inc. Caddo Mills 01/21/2010 11015.00000 33-01-04.2 N TX NE 096-12-17.2 W 0004098300 TierOne Converged Networks, Inc. Caddo Mills 01/21/2010 11075.00000 33-01-04.2 N Page 48 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 080-27-22.7 W 0004098516 TEXAS EASTERN COMMUNICATIONS IWind Ridge 01/21/2010 05945.20000 39-53-29.0 N TX NE 096-46-12.6 W 0004098605 TierOne
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296129A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296129A1.txt
  • 01/28/2010 22575.00000 37-23-15.4 N CA NE 122-05-55.5 W 0004107779 WiLine Networks Inc. Mountain View 01/28/2010 11585.00000 37-25-01.9 N CA NE 122-05-08.6 W 0004107781 WiLine Networks Inc. Mountain View 01/28/2010 10735.00000 37-25-21.1 N CA NE 122-12-17.3 W 0004107786 WiLine Networks Inc. Redwood City 01/28/2010 10815.00000 37-30-40.2 N CA NE 116-23-05.8 W 0004107992 Royal Street BTA 262, LLC Palm Desert 01/29/2010 17910.00000 33-44-04.2 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 116-23-06.7 W 0004107996 Royal Street BTA 262, LLC Palm Desert 01/29/2010 19470.00000 33-43-15.1 N NE NE 098-27-37.3 W 0004108018 USCOC NEBRASKA/KANSAS, LLC St. Paul 01/29/2010 06745.00000 41-12-21.6 N NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296130A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296130A1.txt
  • MSA LIMKILGORE 01/29/2010 06345.49000 32-23-27.0 N TX MD WLL911 095-01-45.1 W 0004110391 TYLER/LONGVIEW/MARSHALL MSA LIMKILGORE 01/29/2010 06785.00000 32-23-27.0 N TX MD WLL911 095-01-45.1 W 0004110391 TYLER/LONGVIEW/MARSHALL MSA LIMKILGORE 01/29/2010 11265.00000 32-23-27.0 N TX MD WMN662 094-41-31.0 W 0004110392 TYLER/LONGVIEW/MARSHALL MSA LIMLONGVIEW 01/29/2010 05945.20000 32-34-22.0 N TX MD WMN662 094-41-31.0 W 0004110392 TYLER/LONGVIEW/MARSHALL MSA LIMLONGVIEW 01/29/2010 05974.85000 32-34-22.0 N MA NE 071-08-04.2 W 0004108158 Towerstream Corp. Boston 01/29/2010 19400.00000 42-33-20.0 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA NE 071-11-57.2 W 0004108161 Towerstream Corp. Boston 01/29/2010 18085.00000 42-17-29.0 N GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296275A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296275A1.txt
  • COMMUNICATION COMALEXANDRIA 02/05/2010 02025.50000 - 02109.50000 31-18-58.6 N LA MD KC26265 P 092-29-00.4 W 0004117585 POLLACK/BELZ COMMUNICATION COMALEXANDRIA 02/05/2010 02109.50000 - 02110.00000 31-18-58.6 N LA MD KC26265 P 092-29-00.4 W 0004117585 POLLACK/BELZ COMMUNICATION COMALEXANDRIA 02/05/2010 02450.00000 - 02467.00000 31-18-58.6 N LA MD KC26265 P 092-29-00.4 W 0004117585 POLLACK/BELZ COMMUNICATION COMALEXANDRIA 02/05/2010 02467.00000 - 02483.50000 31-18-58.6 N CA MD KC26371 P 124-12-04.2 W 0004117606 POLLACK/BELZ BROADCASTING COMPEUREKA 02/05/2010 01990.00000 - 02008.00000 40-44-31.4 N CA MD KC26371 P 124-12-04.2 W 0004117606 POLLACK/BELZ BROADCASTING COMPEUREKA 02/05/2010 02008.00000 - 02110.00000 40-44-31.4 N CA MD KC26371 P 124-12-04.2 W 0004117606 POLLACK/BELZ BROADCASTING COMPEUREKA 02/05/2010 02025.00000 - 02025.50000 40-44-31.4 N Page 51 TP - TV Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296276A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296276A1.txt
  • Number Frequency (MHz) Applicant Name Latitude City FL NE 081-20-34.4 W 0004115715 CLEARWIRE SPECTRUM HOLDINGS IIILONGWOOD 02/04/2010 23225.00000 28-42-50.1 N FL NE 081-21-55.8 W 0004115716 CLEARWIRE SPECTRUM HOLDINGS IIILAKE MARY 02/04/2010 17815.00000 28-44-04.4 N FL NE 081-21-55.8 W 0004115716 CLEARWIRE SPECTRUM HOLDINGS IIILAKE MARY 02/04/2010 17915.00000 28-44-04.4 N FL NE 081-21-21.3 W 0004115717 CLEARWIRE SPECTRUM HOLDINGS IIILake Mary 02/04/2010 21875.00000 28-47-04.2 N FL NE 081-21-21.3 W 0004115717 CLEARWIRE SPECTRUM HOLDINGS IIILake Mary 02/04/2010 22025.00000 28-47-04.2 N IL NE 089-41-34.2 W 0004116440 Southwestern Illinois Health Facilities, IncMaryville, IL 02/04/2010 11605.00000 38-45-45.3 N IL NE 089-41-34.2 W 0004116440 Southwestern Illinois Health Facilities, IncMaryville, IL 02/04/2010 19525.00000 38-45-45.3 N IL NE 089-41-37.5 W 0004116442 Southwestern Illinois Health Facilities, IncHighland IL 02/04/2010 17965.00000 38-44-43.8 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296278A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296278A1.txt
  • 32-58-53.1 N TX MD WQEK366 096-35-26.1 W 0004124735 FiberTower Network Services Corp. SACHSE 02/12/2010 17920.00000 32-58-53.1 N TX MD WQEK366 096-35-26.1 W 0004124735 FiberTower Network Services Corp. SACHSE 02/12/2010 18060.00000 32-58-53.1 N TX MD WQEK366 096-35-26.1 W 0004124735 FiberTower Network Services Corp. SACHSE 02/12/2010 21970.00000 32-58-53.1 N TX MD WQEK363 096-36-07.8 W 0004124737 FiberTower Network Services Corp. GARLAND 02/12/2010 19620.00000 32-58-04.2 N PR MD WQKR631 066-15-04.4 W 0004124830 PR Wireless, Inc. Comerio 02/12/2010 11147.50000 18-14-01.2 N PR MD WQKR631 066-15-04.4 W 0004124830 PR Wireless, Inc. Comerio 02/12/2010 11182.50000 18-14-01.2 N Page 1 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PR MD WPOV402
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296461A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296461A1.txt
  • LLC Menard 02/16/2010 11325.00000 30-46-58.8 N TX NE 099-44-11.5 W 0004125903 Conterra Ultra Broadband, LLC Junction 02/16/2010 10835.00000 30-27-48.1 N TX NE 099-44-11.5 W 0004125903 Conterra Ultra Broadband, LLC Junction 02/16/2010 21880.00000 30-27-48.1 N TX NE 099-46-40.9 W 0004125921 Conterra Ultra Broadband, LLC Junction 02/16/2010 23080.00000 30-29-13.3 N TX NE 099-18-29.0 W 0004125926 Conterra Ultra Broadband, LLC Mason 02/16/2010 10795.00000 30-47-04.2 N TX NE 099-18-29.0 W 0004125926 Conterra Ultra Broadband, LLC Mason 02/16/2010 19350.00000 30-47-04.2 N TX NE 099-14-50.2 W 0004125927 Conterra Ultra Broadband, LLC MASON 02/16/2010 17790.00000 30-44-54.6 N TX NE 099-14-50.2 W 0004125927 Conterra Ultra Broadband, LLC MASON 02/16/2010 23060.00000 30-44-54.6 N TX NE 099-14-31.0 W 0004125929 Conterra Ultra Broadband, LLC Mason 02/16/2010 21860.00000 30-44-36.7 N TX NE 099-17-08.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296463A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296463A1.txt
  • W 0004128763 CLEARWIRE SPECTRUM HOLDINGS IIIAURORA 02/17/2010 11465.00000 39-39-54.9 N CO NE 104-51-39.9 W 0004128763 CLEARWIRE SPECTRUM HOLDINGS IIIAURORA 02/17/2010 11545.00000 39-39-54.9 N CO NE 104-51-39.9 W 0004128763 CLEARWIRE SPECTRUM HOLDINGS IIIAURORA 02/17/2010 23125.00000 39-39-54.9 N CO NE 104-51-39.9 W 0004128763 CLEARWIRE SPECTRUM HOLDINGS IIIAURORA 02/17/2010 23275.00000 39-39-54.9 N CO NE 104-50-53.5 W 0004128872 CLEARWIRE SPECTRUM HOLDINGS IIIAurora 02/18/2010 21925.00000 39-42-04.2 N CO NE 104-50-53.5 W 0004128872 CLEARWIRE SPECTRUM HOLDINGS IIIAurora 02/18/2010 22075.00000 39-42-04.2 N VA NE 077-15-27.6 W 0004129348 CLEARWIRE SPECTRUM HOLDINGS IIIBURKE 02/18/2010 23025.00000 38-46-47.7 N VA NE 077-14-15.7 W 0004129351 CLEARWIRE SPECTRUM HOLDINGS IIISpringfield 02/18/2010 23125.00000 38-48-12.6 N UT NE 111-53-14.8 W 0004129456 CLEARWIRE SPECTRUM HOLDINGS IIISalt Lake City 02/18/2010 22025.00000 40-45-18.0 N UT NE 111-55-21.5 W 0004129460
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296480A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296480A1.txt
  • 12,973 49.6 843 3.2 186 0.7 829 3.2 340 1.3 10,990 42.0 26,161 Texas 50,850 46.0 2,502 2.3 631 0.6 3,056 2.8 2,154 1.9 51,446 46.5 110,640 Utah 6,258 56.6 65 0.6 61 0.6 266 2.4 158 1.4 4,254 38.5 11,062 Vermont 2,374 45.2 4 0.1 84 1.6 49 0.9 59 1.1 2,682 51.1 5,253 Virgin Islands 170 47.3 15 4.2 31 8.6 46 12.7 2 0.5 96 26.7 360 Virginia 18,724 59.6 36 0.1 259 0.8 1,061 3.4 285 0.9 11,056 35.2 31,420 Washington 15,836 57.6 67 0.2 132 0.5 753 2.7 464 1.7 10,264 37.3 27,515 West Virginia 2,742 41.4 49 0.7 71 1.1 110 1.7 66 1.0 3,586 54.1 6,625 Wisconsin 10,683 39.8 190 0.7 158 0.6 434
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296634A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296634A1.txt
  • HOLDINGS IIIHouston 02/23/2010 23225.00000 29-46-40.1 N TX NE 095-19-56.9 W 0004134184 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/23/2010 22075.00000 29-53-45.1 N TX NE 095-18-28.1 W 0004134185 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/23/2010 11465.00000 29-59-15.5 N TX NE 095-11-40.8 W 0004134186 CLEARWIRE SPECTRUM HOLDINGS IIIPasadena 02/23/2010 22025.00000 29-38-18.8 N TX NE 095-29-49.2 W 0004134187 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/23/2010 22025.00000 29-42-55.4 N TX NE 095-40-04.2 W 0004134188 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/23/2010 22025.00000 29-42-02.1 N TX NE 095-36-27.6 W 0004134189 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/23/2010 22025.00000 29-44-48.1 N Page 37 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 095-16-12.8 W 0004134190 CLEARWIRE SPECTRUM HOLDINGS IIIHOUSTON 02/23/2010 23275.00000 29-39-32.8 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296635A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296635A1.txt
  • 0004136980 NORTH DAKOTA RSA NO. 3 LIMITED PALidgerwood 02/25/2010 46-03-50.2 N MS MD KNKQ448 090-03-25.2 W 0004137083 ALLTEL Wireless of Mississippi RSA #5, LVaughan 02/25/2010 32-47-20.7 N MS MD KNKQ448 090-46-46.2 W 0004137083 ALLTEL Wireless of Mississippi RSA #5, LVicksburg 02/25/2010 32-21-30.0 N TX MD KNKQ272 096-55-56.0 W 0004137221 ALLTEL Communications of Texas LimitedPENELOPE 02/25/2010 31-48-44.0 N WY MD KNKN259 111-01-04.2 W 0004137520 UNION TELEPHONE COMPANY Alpine 02/25/2010 43-10-27.1 N WY MD KNKN259 106-09-08.6 W 0004137520 UNION TELEPHONE COMPANY Elk Mountain 02/25/2010 41-42-01.1 N WY MD KNKN259 108-35-02.0 W 0004137520 UNION TELEPHONE COMPANY Hudson 02/25/2010 42-53-37.8 N Page 9 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WY MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296749A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296749A1.txt
  • Xiocom Wireless Inc Meramar Beach 03/01/2010 10915.00000 30-22-25.2 N FL NE 086-21-07.8 W 0004140837 Xiocom Wireless Inc Meramar Beach 03/01/2010 11115.00000 30-22-25.2 N OR NE 122-01-11.8 W 0004141717 KEZI, Inc. La Pine 03/02/2010 06004.50000 43-36-23.8 N OR NE 122-13-42.0 W 0004141720 KEZI, Inc. Oakridge 03/02/2010 06256.54000 43-37-00.0 N TX NE 100-12-44.4 W 0004143467 Enbridge Energy Company, Inc. ALLISON 03/02/2010 05945.20000 35-36-04.2 N TX NE 100-12-44.4 W 0004143467 Enbridge Energy Company, Inc. ALLISON 03/02/2010 05974.85000 35-36-04.2 N TX NE 100-12-44.4 W 0004143467 Enbridge Energy Company, Inc. ALLISON 03/02/2010 06004.50000 35-36-04.2 N TX NE 100-12-44.4 W 0004143467 Enbridge Energy Company, Inc. ALLISON 03/02/2010 06345.49000 35-36-04.2 N OK NE 099-50-35.0 W 0004143469 Enbridge Energy Company, Inc. SWEETWATER 03/02/2010 06197.24000 35-25-24.0 N OK NE 099-50-35.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296750A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296750A1.txt
  • 33-46-00.1 N CA NE 118-07-26.6 W 0004142008 CLEARWIRE SPECTRUM HOLDINGS IIILong Beach 03/02/2010 21975.00000 33-49-07.1 N CA NE 118-05-02.5 W 0004142009 CLEARWIRE SPECTRUM HOLDINGS IIILong Beach 03/02/2010 23025.00000 33-49-33.3 N CA NE 118-19-32.3 W 0004142010 CLEARWIRE SPECTRUM HOLDINGS IIITorrance 03/02/2010 23175.00000 33-52-15.2 N CA NE 118-03-06.5 W 0004142011 CLEARWIRE SPECTRUM HOLDINGS IIISanta Fe Springs 03/02/2010 23025.00000 33-56-00.7 N CA NE 117-56-04.2 W 0004142012 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 03/02/2010 19375.00000 34-03-29.6 N CA NE 117-56-04.2 W 0004142012 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 03/02/2010 19475.00000 34-03-29.6 N CA NE 117-50-54.0 W 0004142013 CLEARWIRE SPECTRUM HOLDINGS IIIWalnut 03/02/2010 19525.00000 34-00-58.1 N CA NE 117-50-54.0 W 0004142013 CLEARWIRE SPECTRUM HOLDINGS IIIWalnut 03/02/2010 19575.00000 34-00-58.1 N CA NE 117-50-54.0 W 0004142013 CLEARWIRE SPECTRUM HOLDINGS IIIWalnut
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296752A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296752A1.txt
  • 096-56-53.9 W 0004144380 CLEARWIRE SPECTRUM HOLDINGS IIILittle Elm 03/03/2010 19525.00000 33-09-13.8 N TX MD WQLD866 096-56-53.9 W 0004144380 CLEARWIRE SPECTRUM HOLDINGS IIILittle Elm 03/03/2010 19575.00000 33-09-13.8 N TX MD WQLD866 096-56-53.9 W 0004144380 CLEARWIRE SPECTRUM HOLDINGS IIILittle Elm 03/03/2010 19625.00000 33-09-13.8 N TX MD WQLD866 096-56-53.9 W 0004144380 CLEARWIRE SPECTRUM HOLDINGS IIILittle Elm 03/03/2010 19675.00000 33-09-13.8 N TX MD WQLE637 096-43-04.2 W 0004144381 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 03/03/2010 10775.00000 33-02-31.2 N TX MD WQLE637 096-43-04.2 W 0004144381 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 03/03/2010 10895.00000 33-02-31.2 N Page 35 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WQLE637 096-43-04.2 W 0004144381 CLEARWIRE SPECTRUM HOLDINGS IIIPlano 03/03/2010 11055.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296755A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296755A1.txt
  • 06745.00000 36-18-24.6 N NC MD WQJA899 076-21-05.2 W 0004140380 North Carolina State Highway Patrol South Mills 03/01/2010 06585.00000 36-31-02.9 N OH MD WNTD954 081-03-34.3 W 0004140472 GEAUGA, COUNTY OF PARKMAN 03/01/2010 05945.20000 41-24-28.2 N OH MD WNTD954 081-03-34.3 W 0004140472 GEAUGA, COUNTY OF PARKMAN 03/01/2010 11365.00000 41-24-28.2 N OH MD WNTD953 081-19-35.3 W 0004140473 GEAUGA, COUNTY OF BAINBRIDGE 03/01/2010 10715.00000 41-23-04.2 N OH MD WNTD953 081-19-35.3 W 0004140473 GEAUGA, COUNTY OF BAINBRIDGE 03/01/2010 10875.00000 41-23-04.2 N ID MD KOB39 116-05-45.4 W 0004141196 IDAHO, STATE OF BOISE 03/01/2010 06226.89000 43-45-15.6 N ID MD KOB39 116-05-45.4 W 0004141196 IDAHO, STATE OF BOISE 03/01/2010 06286.19000 43-45-15.6 N ID MD KOB39 116-05-45.4 W 0004141196 IDAHO, STATE OF BOISE 03/01/2010 06404.79000 43-45-15.6 N ID MD KOB39
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296906A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296906A1.txt
  • subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI AM 084-57-18.9 W 0004130523 City of Marshall, Brooks Field Airport Marshall 03/10/2010 00122.80000 42-15-04.2 N IN NE 086-49-24.0 W 0004149832 Michigan City Municipal Airport Migican City 03/08/2010 00122.70000 41-42-15.7 N NE NE 098-41-15.0 W 0004153727 O'neill Airport Authority O'Neill 03/08/2010 00122.80000 42-28-02.0 N MS NE 090-55-42.4 W 0004154226 Vicksburg, City of Vicksburg 03/09/2010 00122.80000 32-14-21.5 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297036A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297036A1.txt
  • IIIUNIVERSITY CITY 03/15/2010 21975.00000 38-40-42.0 N IL NE 089-55-36.0 W 0004167739 CLEARWIRE SPECTRUM HOLDINGS IIIO'Fallon 03/15/2010 11225.00000 38-36-28.0 N IL NE 089-55-36.0 W 0004167739 CLEARWIRE SPECTRUM HOLDINGS IIIO'Fallon 03/15/2010 11345.00000 38-36-28.0 N IL NE 090-01-29.7 W 0004167740 CLEARWIRE SPECTRUM HOLDINGS IIICollinsville 03/15/2010 17815.00000 38-39-45.3 N IL NE 090-01-29.7 W 0004167740 CLEARWIRE SPECTRUM HOLDINGS IIICollinsville 03/15/2010 17915.00000 38-39-45.3 N MO NE 090-17-04.2 W 0004167741 CLEARWIRE SPECTRUM HOLDINGS IIIFlorissant 03/15/2010 23025.00000 38-47-31.4 N MO NE 090-17-04.2 W 0004167741 CLEARWIRE SPECTRUM HOLDINGS IIIFlorissant 03/15/2010 23125.00000 38-47-31.4 N MO NE 090-17-04.2 W 0004167741 CLEARWIRE SPECTRUM HOLDINGS IIIFlorissant 03/15/2010 23175.00000 38-47-31.4 N MO NE 090-17-04.2 W 0004167741 CLEARWIRE SPECTRUM HOLDINGS IIIFlorissant 03/15/2010 23275.00000 38-47-31.4 N MO NE 090-21-28.0 W 0004167743 CLEARWIRE SPECTRUM HOLDINGS IIIHAZELWOOD 03/15/2010 11265.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297204A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297204A1.txt
  • RSA 2 LIMITED PARTNERSHIP d/BELLEVUE 03/22/2010 06226.89000 41-14-17.0 N OH MD WPOQ355 082-50-16.0 W 0004182845 OHIO RSA 2 LIMITED PARTNERSHIP d/BELLEVUE 03/22/2010 06286.19000 41-14-17.0 N OH MD WPOQ355 082-50-16.0 W 0004182845 OHIO RSA 2 LIMITED PARTNERSHIP d/BELLEVUE 03/22/2010 06775.00000 41-14-17.0 N OH MD WPOQ355 082-50-16.0 W 0004182845 OHIO RSA 2 LIMITED PARTNERSHIP d/BELLEVUE 03/22/2010 06815.00000 41-14-17.0 N SC MD WQHP942 082-16-04.2 W 0004183036 Conterra Ultra Broadband, LLC Taylors 03/23/2010 11365.00000 34-56-49.4 N SC MD WQHP942 082-16-04.2 W 0004183036 Conterra Ultra Broadband, LLC Taylors 03/23/2010 11405.00000 34-56-49.4 N Page 12 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC MD WQHD210 079-22-08.0 W 0004183037
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297269A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297269A2.txt
  • 0.0 22.2 77.8 $906,837 0.0 0.0 0.0 0.0100.0 410,491,388 0.0 1.5 7.9 29.5 61.1 Yemen $9,738,248 0.0 0.4 1.3 31.4 66.9 $202,088 0.0 0.0 0.0 7.9 92.1 $7,896 0.0 0.0 0.0 0.0100.0 90,804,637 0.0 4.0 1.1 28.8 66.1 Middle East $265,324,450 0.0 0.4 4.5 21.8 73.2 $10,733,517 0.0 0.0 0.0 16.2 83.8 $9,076,291 0.0 0.0 0.0 0.0100.0 2,755,525,811 0.0 0.4 4.2 26.6 68.8 Anguilla $1,246,217 0.0 0.0 0.0 20.9 79.0 $10,404 0.0 0.0 0.0 0.0100.0 $204,634 0.0 0.0 0.0 0.0100.0 6,948,645 0.0 0.0 0.0 25.3 74.7 Antigua and Barbuda $4,277,235 0.0 0.0 0.1 22.4 77.5 $52,596 0.0 0.0 0.0 0.0100.0 $103,406 0.0 0.0 0.0 0.0100.0 36,439,428 0.0 0.0 0.1 25.5 74.4 Aruba $4,898,908 0.0 0.0 0.4 14.1 85.5 $69,952 0.0 0.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297358A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297358A1.txt
  • Tucson 03/29/2010 21925.00000 32-16-44.1 N AZ NE 110-58-04.8 W 0004190082 Cricket Communications, Inc Tucson 03/29/2010 23025.00000 32-15-51.2 N AZ NE 110-58-04.8 W 0004190082 Cricket Communications, Inc Tucson 03/29/2010 23075.00000 32-15-51.2 N AZ NE 110-58-35.6 W 0004190083 Cricket Communications, Inc Tucson 03/29/2010 21875.00000 32-17-29.3 N MO NE 094-29-19.2 W 0004190136 USCOC OF GREATER MISSOURI, LLCNoel 03/29/2010 06605.00000 36-33-31.1 N MS NE 089-09-04.2 W 0004190171 ALLTEL Communications of Mississippi RNoxapater 03/29/2010 06063.80000 33-00-20.8 N MS NE 089-09-04.2 W 0004190171 ALLTEL Communications of Mississippi RNoxapater 03/29/2010 06093.45000 33-00-20.8 N MS NE 089-02-32.0 W 0004190184 ALLTEL Communications of Mississippi RLOUISVILLE 03/29/2010 06315.84000 33-06-54.0 N MS NE 089-17-26.6 W 0004190458 ALLTEL Communications of Mississippi RKerr 03/29/2010 06345.49000 32-56-59.8 N OR NE 117-17-51.5 W 0004190871 OREGON RSA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297359A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297359A1.txt
  • and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MT NE 104-31-33.0 W 0004197784 State of Montana Aeronautics Division Plentywood 04/02/2010 00122.80000 48-47-19.0 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL MD WPOL665 080-05-04.2 W 0004197711 CLEAR CHANNEL BROADCASTING LICWest Palm Beach 04/02/2010 00950.00000 26-45-25.8 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City LA AM WQJC240 090-47-33.5 W 0004096900 Verizon Wireless Personal CommunicationHouma 04/02/2010 06226.89000 29-36-55.9 N LA AM WQJC240 090-47-33.5 W 0004096900 Verizon Wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297472A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297472A1.txt
  • Number Frequency (MHz) Applicant Name Latitude City CA NE 120-34-00.0 W 0004202464 City of Alturas Alturas 04/07/2010 00122.80000 41-29-00.0 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO AM WQLR679 106-00-56.0 W 0004036966 THREE EAGLES COMMUNICATIONS OFSalida 04/07/2010 00946.00000 38-31-55.0 N FL MD WPOU511 080-05-04.2 W 0004202437 CLEAR CHANNEL BROADCASTING LICWEST PALM BEAC 04/07/2010 00950.00000 26-45-25.8 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WLT805 118-24-59.3 W 0004194891 Los Angeles SMSA Limited Partnership LOS ANGELES 04/07/2010 11325.00000 34-03-42.0 N Page 1 CF - Common
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297624A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297624A1.txt
  • 40-23-01.0 N PA NE 080-02-39.1 W 0004209054 CLEARWIRE SPECTRUM HOLDINGS IIIMount Lebanon 04/13/2010 19675.00000 40-23-01.0 N PA NE 080-02-39.1 W 0004209054 CLEARWIRE SPECTRUM HOLDINGS IIIMount Lebanon 04/13/2010 23225.00000 40-23-01.0 N PA NE 080-02-39.1 W 0004209054 CLEARWIRE SPECTRUM HOLDINGS IIIMount Lebanon 04/13/2010 23275.00000 40-23-01.0 N PA NE 079-54-36.8 W 0004209055 CLEARWIRE SPECTRUM HOLDINGS IIIWest Mifflin 04/13/2010 10775.00000 40-21-22.2 N PA NE 079-59-04.2 W 0004209056 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 04/13/2010 18015.00000 40-21-55.9 N PA NE 079-59-04.2 W 0004209056 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 04/13/2010 18115.00000 40-21-55.9 N PA NE 079-59-04.2 W 0004209056 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 04/13/2010 23025.00000 40-21-55.9 N PA NE 079-59-04.2 W 0004209056 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 04/13/2010 23175.00000 40-21-55.9 N PA NE 080-05-18.0 W 0004209057 CLEARWIRE SPECTRUM HOLDINGS IIIScott Township 04/13/2010
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297625A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297625A1.txt
  • HOLDINGS IIIWakefield 04/16/2010 22075.00000 42-29-56.5 N MA NE 071-08-57.8 W 0004215595 CLEARWIRE SPECTRUM HOLDINGS IIICANTON 04/16/2010 10775.00000 42-09-31.7 N MA NE 071-08-57.8 W 0004215595 CLEARWIRE SPECTRUM HOLDINGS IIICANTON 04/16/2010 10815.00000 42-09-31.7 N MA NE 071-08-57.8 W 0004215595 CLEARWIRE SPECTRUM HOLDINGS IIICANTON 04/16/2010 19625.00000 42-09-31.7 N MA NE 071-08-57.8 W 0004215595 CLEARWIRE SPECTRUM HOLDINGS IIICANTON 04/16/2010 23175.00000 42-09-31.7 N MA NE 071-05-04.2 W 0004215596 CLEARWIRE SPECTRUM HOLDINGS IIICambridge 04/16/2010 22175.00000 42-21-43.9 N MA NE 071-08-34.9 W 0004215597 CLEARWIRE SPECTRUM HOLDINGS IIIDedham 04/16/2010 21825.00000 42-14-13.7 N MA NE 071-08-34.9 W 0004215597 CLEARWIRE SPECTRUM HOLDINGS IIIDedham 04/16/2010 22075.00000 42-14-13.7 N MA NE 071-08-34.9 W 0004215597 CLEARWIRE SPECTRUM HOLDINGS IIIDedham 04/16/2010 23125.00000 42-14-13.7 N MA NE 071-08-58.9 W 0004215598 CLEARWIRE SPECTRUM HOLDINGS IIIBrookline 04/16/2010 18065.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297626A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297626A1.txt
  • 29-55-13.7 N TX NE 095-43-45.7 W 0004213371 Cy-Fair Volunteer Fire Department KATY 04/15/2010 11245.00000 29-50-40.0 N CA NE 117-34-32.9 W 0004214424 CORONA, CITY OF - FIRE COMMUNICACORONA 04/15/2010 19640.00000 33-53-15.4 N MA NE 070-05-16.1 W 0004214503 Nantucket Police Department Nantucket 04/16/2010 10563.12500 41-16-03.4 N MA NE 070-04-16.7 W 0004214504 Nantucket Police Department Nantucket 04/16/2010 10628.12500 41-16-24.3 N OR RM WPQP231 123-00-04.2 W 0004214962 Eugene, City of Eugene 04/16/2010 10563.12500 44-06-54.3 N Page 5 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPQN885 0004206530 Riverside, County of 04/12/2010 RO WPQN886 0004206536 Riverside, County of 04/12/2010 RO WPQN887 0004206553 Riverside, County of 04/12/2010 RO WPQN888 0004206587 Riverside,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297768A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297768A1.txt
  • CLEARWIRE SPECTRUM HOLDINGS IIIBillerica 04/19/2010 10935.00000 42-33-33.1 N MA NE 071-16-10.2 W 0004215841 CLEARWIRE SPECTRUM HOLDINGS IIIBillerica 04/19/2010 19375.00000 42-33-33.1 N MA NE 071-16-10.2 W 0004215841 CLEARWIRE SPECTRUM HOLDINGS IIIBillerica 04/19/2010 21925.00000 42-33-33.1 N MA NE 071-18-13.7 W 0004215842 CLEARWIRE SPECTRUM HOLDINGS IIINorth Billerica 04/19/2010 19425.00000 42-33-34.1 N MA NE 071-10-18.9 W 0004215843 CLEARWIRE SPECTRUM HOLDINGS IIIWest Roxbury 04/19/2010 23125.00000 42-17-04.2 N MA NE 071-09-50.3 W 0004215845 CLEARWIRE SPECTRUM HOLDINGS IIIWest Roxbury 04/19/2010 17865.00000 42-18-10.3 N MA NE 070-56-44.8 W 0004215846 CLEARWIRE SPECTRUM HOLDINGS IIIPeabody 04/19/2010 21825.00000 42-32-40.6 N MA NE 071-24-58.8 W 0004215847 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/19/2010 23275.00000 42-16-41.8 N MA NE 071-24-58.8 W 0004215847 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/19/2010 23325.00000 42-16-41.8 N MA NE 071-24-58.8 W 0004215847 CLEARWIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297771A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297771A1.txt
  • N NC MD WQKY378 081-12-41.0 W 0004221011 CLEARWIRE SPECTRUM HOLDINGS IIIGastonia 04/22/2010 19375.00000 35-15-40.4 N NC MD WQKY378 081-12-41.0 W 0004221011 CLEARWIRE SPECTRUM HOLDINGS IIIGastonia 04/22/2010 19475.00000 35-15-40.4 N NC MD WQKY378 081-12-41.0 W 0004221011 CLEARWIRE SPECTRUM HOLDINGS IIIGastonia 04/22/2010 19575.00000 35-15-40.4 N NC MD WQKY698 080-51-20.0 W 0004221012 CLEARWIRE SPECTRUM HOLDINGS IIICornelius 04/22/2010 19325.00000 35-29-12.0 N NC MD WQKY541 080-35-04.2 W 0004221013 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 04/22/2010 11225.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0004221013 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 04/22/2010 11265.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0004221013 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 04/22/2010 11345.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0004221013 CLEARWIRE SPECTRUM HOLDINGS IIIMONROE 04/22/2010 11505.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0004221013 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297887A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297887A1.txt
  • 0004224507 Verizon Wireless (VAW) LLC North Plains 04/26/2010 06315.84000 45-44-38.7 N OR MD WQKV383 123-08-07.6 W 0004224507 Verizon Wireless (VAW) LLC North Plains 04/26/2010 10623.12500 45-44-38.7 N OR MD WQKV383 123-08-07.6 W 0004224507 Verizon Wireless (VAW) LLC North Plains 04/26/2010 10755.00000 45-44-38.7 N CA MD WMV939 117-57-30.4 W 0004225003 AT&T CALIFORNIA LITTLE ROCK 04/26/2010 10755.00000 34-31-14.9 N CA MD WLA630 117-46-04.2 W 0004225004 AT&T CALIFORNIA PALMDALE 04/26/2010 11245.00000 34-28-11.5 N CA MD WPYW215 116-51-55.2 W 0004225722 Verizon Wireless (VAW) LLC Lakeside 04/27/2010 10552.50000 32-56-20.7 N CA MD WPYW215 116-51-55.2 W 0004225722 Verizon Wireless (VAW) LLC Lakeside 04/27/2010 10553.12500 32-56-20.7 N NV MD WPJF592 115-05-21.8 W 0004225726 WWC License L.L.C. Kimberly 04/27/2010 06004.50000 39-18-52.8 N NV MD WPJF592 115-05-21.8 W 0004225726 WWC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297888A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297888A1.txt
  • W 0004226459 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 04/28/2010 23125.00000 29-41-22.0 N TX MD WQLS541 095-34-57.4 W 0004226460 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 04/28/2010 17865.00000 29-58-07.3 N Page 36 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WQLL405 095-36-24.0 W 0004226461 CLEARWIRE SPECTRUM HOLDINGS IIITomball 04/28/2010 10735.00000 29-56-04.2 N TX MD WQLL405 095-36-24.0 W 0004226461 CLEARWIRE SPECTRUM HOLDINGS IIITomball 04/28/2010 10895.00000 29-56-04.2 N TX MD WQLL405 095-36-24.0 W 0004226461 CLEARWIRE SPECTRUM HOLDINGS IIITomball 04/28/2010 19375.00000 29-56-04.2 N TX MD WQLL405 095-36-24.0 W 0004226461 CLEARWIRE SPECTRUM HOLDINGS IIITomball 04/28/2010 19475.00000 29-56-04.2 N TX MD WQLS676 095-28-45.1 W 0004226462 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 04/28/2010 19525.00000 29-40-44.4 N TX MD WQLS676
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297889A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297889A1.txt
  • WPPC294 X 0004229931 P.E.C. MOBILE COMMUNICATIONS 04/30/2010 00456.45000 IL MD WPPC294 X 0004229931 P.E.C. MOBILE COMMUNICATIONS 04/30/2010 00456.75000 IL MD WPPC294 X 0004229931 P.E.C. MOBILE COMMUNICATIONS 04/30/2010 00457.15000 IL MD WPPC294 X 0004229931 P.E.C. MOBILE COMMUNICATIONS 04/30/2010 00457.27500 IL MD WPPC294 X 0004229931 P.E.C. MOBILE COMMUNICATIONS 04/30/2010 00457.82500 IL MD WPPC294 089-39-02.4 W 0004229931 P.E.C. MOBILE COMMUNICATIONS SPRINGFIELD 04/30/2010 00451.45000 39-48-04.2 N IL MD WPPC294 089-39-02.4 W 0004229931 P.E.C. MOBILE COMMUNICATIONS SPRINGFIELD 04/30/2010 00451.75000 39-48-04.2 N IL MD WPPC294 089-39-02.4 W 0004229931 P.E.C. MOBILE COMMUNICATIONS SPRINGFIELD 04/30/2010 00452.15000 39-48-04.2 N IL MD WPPC294 089-39-02.4 W 0004229931 P.E.C. MOBILE COMMUNICATIONS SPRINGFIELD 04/30/2010 00452.27500 39-48-04.2 N IL MD WPPC294 089-39-02.4 W 0004229931 P.E.C. MOBILE COMMUNICATIONS SPRINGFIELD 04/30/2010 00452.82500 39-48-04.2 N Page 40 Land
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297986A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297986A1.txt
  • 21,655 21,713 21,064 21,188 21,640 21,793 22,472 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 75,939 75,477 75,872 76,185 * Current dollar equivalents are at the end of Table 4 82 Alabama 6.4 Montana 5.7 Alaska 6.0 Nebraska 6.0 Arizona 6.7 Nevada 4.8 Arkansas 5.5 New Hampshire 4.1 California 2.4 New Jersey 4.5 Colorado 4.4 New Mexico 8.5 Connecticut 4.2 New York 3.3 Delaware 5.2 North Carolina 4.6 District Of Columbia 6.3 North Dakota 5.6 Florida 2.8 Ohio 3.9 Georgia 5.7 Oklahoma 5.5 Hawaii 6.2 Oregon 5.1 Idaho 4.9 Pennsylvania 3.4 Illinois 4.5 Rhode Island 5.0 Indiana 5.9 South Carolina 5.1 Iowa 4.3 South Dakota 4.9 Kansas 4.9 Tennessee 6.3 Kentucky 5.5 Texas 3.1 Louisiana 8.5 Utah 5.4 Maine 4.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298239A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298239A1.txt
  • STATE UNIVERSITY MUSKEGON 05/10/2010 00949.62500 43-08-03.0 N Page 1 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI MD WHS315 086-15-37.0 W 0004239370 GRAND VALLEY STATE UNIVERSITY MUSKEGON 05/10/2010 00950.00000 43-08-03.0 N FL MD WPOP968 081-51-18.3 W 0004239713 MERIDIAN BROADCASTING, INC. FT Myers 05/10/2010 00944.50000 26-39-04.2 N OR MD WQHD795 122-54-08.1 W 0004240919 UCB USA, INC. MEDFORD 05/11/2010 00945.00000 42-20-30.4 N NY MD WJN20 073-42-01.8 W 0004241476 WMHT EDUCATIONAL TELECOMMUNICTROY 05/11/2010 00950.00000 42-41-01.3 N MT MD WGZ696 114-16-46.6 W 0004241832 KALISPELL CHRISTIAN RADIO FELLOWKALISPELL 05/11/2010 00950.00000 48-14-22.2 N NY NE 078-25-48.5 W 0004240870 COLONIAL RADIO GROUP, INC. Olean 05/11/2010 00947.50000 42-04-45.8 N NY NE 078-25-48.5 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298240A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298240A1.txt
  • 17865.00000 39-52-43.8 N PA MD WQKT683 075-23-49.4 W 0004246931 CLEARWIRE SPECTRUM HOLDINGS IIIBrookhaven 05/13/2010 21875.00000 39-52-43.8 N NJ MD WQKR858 074-58-39.0 W 0004246942 CLEARWIRE SPECTRUM HOLDINGS IIICherry Hill 05/13/2010 23075.00000 39-54-39.6 N NJ MD WQKR858 074-58-39.0 W 0004246942 CLEARWIRE SPECTRUM HOLDINGS IIICherry Hill 05/13/2010 23225.00000 39-54-39.6 N PA MD WQKW559 075-35-28.3 W 0004246945 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 05/13/2010 10735.00000 39-58-04.2 N PA MD WQKW559 075-35-28.3 W 0004246945 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 05/13/2010 10815.00000 39-58-04.2 N PA MD WQKW559 075-35-28.3 W 0004246945 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 05/13/2010 10895.00000 39-58-04.2 N PA MD WQKW559 075-35-28.3 W 0004246945 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 05/13/2010 11095.00000 39-58-04.2 N PA MD WQKW559 075-35-28.3 W 0004246945 CLEARWIRE SPECTRUM HOLDINGS IIIWEST GOSHEN 05/13/2010 11175.00000 39-58-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298388A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298388A1.txt
  • W 0004249635 CLEARWIRE SPECTRUM HOLDINGS IIIRochester 05/17/2010 17965.00000 43-07-05.2 N NY NE 077-33-15.1 W 0004249635 CLEARWIRE SPECTRUM HOLDINGS IIIRochester 05/17/2010 18065.00000 43-07-05.2 N NY NE 076-08-42.5 W 0004249636 CLEARWIRE SPECTRUM HOLDINGS IIISyracuse 05/17/2010 23025.00000 43-00-05.4 N NY NE 076-08-42.5 W 0004249636 CLEARWIRE SPECTRUM HOLDINGS IIISyracuse 05/17/2010 23125.00000 43-00-05.4 N NY NE 077-48-24.2 W 0004249637 CLEARWIRE SPECTRUM HOLDINGS IIISpencerport 05/17/2010 11225.00000 43-11-04.2 N NY NE 077-48-24.2 W 0004249637 CLEARWIRE SPECTRUM HOLDINGS IIISpencerport 05/17/2010 11385.00000 43-11-04.2 N NY NE 077-48-24.2 W 0004249637 CLEARWIRE SPECTRUM HOLDINGS IIISpencerport 05/17/2010 23125.00000 43-11-04.2 N NY NE 077-48-24.2 W 0004249637 CLEARWIRE SPECTRUM HOLDINGS IIISpencerport 05/17/2010 23225.00000 43-11-04.2 N NY NE 076-12-39.1 W 0004249639 CLEARWIRE SPECTRUM HOLDINGS IIILiverpool 05/17/2010 17815.00000 43-06-42.4 N NY NE 076-12-39.1 W 0004249639 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298389A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298389A1.txt
  • N CA MD WQLN834 118-15-13.3 W 0004250313 CLEARWIRE SPECTRUM HOLDINGS IIICarson 05/17/2010 23125.00000 33-50-28.9 N CA MD WQLN834 118-15-13.3 W 0004250313 CLEARWIRE SPECTRUM HOLDINGS IIICarson 05/17/2010 23275.00000 33-50-28.9 N IL MD WQLQ916 089-26-37.2 W 0004250458 N-1 Communications, LLC Metamora 05/18/2010 10755.00000 40-46-30.7 N IL MD WQLQ916 089-26-37.2 W 0004250458 N-1 Communications, LLC Metamora 05/18/2010 10855.00000 40-46-30.7 N IL MD WQLQ918 089-29-04.2 W 0004250477 N-1 Communications, LLC Chillicothe 05/18/2010 11345.00000 40-55-18.5 N IL MD WQLQ918 089-29-04.2 W 0004250477 N-1 Communications, LLC Chillicothe 05/18/2010 11405.00000 40-55-18.5 N NY MD WNEK632 075-13-20.5 W 0004250582 POWER AUTHORITY OF THE STATE OFMARCY 05/17/2010 06256.54000 43-10-51.2 N NY MD WNEK633 075-24-58.6 W 0004250592 POWER AUTHORITY OF THE STATE OFCONSTABLEVILLE 05/17/2010 05945.20000 43-30-36.2 N NY MD WNEK633 075-24-58.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298546A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298546A1.txt
  • CELLTELCOWAVERLY 05/25/2010 06755.00000 42-45-29.0 N IA MD WLV701 092-25-58.0 W 0004259210 WATERLOO/CEDAR FALLS CELLTELCOWAVERLY 05/25/2010 06775.00000 42-45-29.0 N IA MD WLV701 092-25-58.0 W 0004259210 WATERLOO/CEDAR FALLS CELLTELCOWAVERLY 05/25/2010 06785.00000 42-45-29.0 N IA MD WLV701 092-25-58.0 W 0004259210 WATERLOO/CEDAR FALLS CELLTELCOWAVERLY 05/25/2010 06815.00000 42-45-29.0 N IA MD WPTD763 092-19-42.0 W 0004259218 WATERLOO/CEDAR FALLS CELLTELCOFREDERIKA 05/25/2010 06745.00000 42-52-33.9 N CA MD KML50 124-05-04.2 W 0004259381 Verizon West Coast Inc. ORICK 05/25/2010 05945.20000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0004259381 Verizon West Coast Inc. ORICK 05/25/2010 06004.50000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0004259381 Verizon West Coast Inc. ORICK 05/25/2010 06034.15000 41-16-49.4 N CA MD KML50 124-05-04.2 W 0004259381 Verizon West Coast Inc. ORICK 05/25/2010 06123.10000 41-16-49.4 N CA MD KML50 124-05-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298547A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298547A1.txt
  • Open Range Communications Steubenville 05/27/2010 23030.00000 40-21-37.9 N Page 33 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC NE 082-25-21.3 W 0004263403 Open Range Communications GREENVILLE 05/28/2010 17750.00000 34-47-37.5 N SC NE 082-25-21.3 W 0004263403 Open Range Communications GREENVILLE 05/28/2010 17830.00000 34-47-37.5 N CA NE 117-07-04.2 W 0004263727 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 05/28/2010 17815.00000 32-53-33.1 N CA NE 117-07-04.2 W 0004263727 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 05/28/2010 17915.00000 32-53-33.1 N CA NE 117-07-04.2 W 0004263727 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 05/28/2010 21875.00000 32-53-33.1 N CA NE 117-07-04.2 W 0004263727 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 05/28/2010 21975.00000 32-53-33.1 N CA NE 116-54-55.4 W 0004263731 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298677A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298677A1.txt
  • LLC NEWBERG 06/01/2010 17760.00000 45-21-09.0 N OR MD WQJR653 122-59-00.7 W 0004266673 Freewire Broadband LLC NEWBERG 06/01/2010 19460.00000 45-21-09.0 N OR MD WQKK324 122-40-46.9 W 0004266758 Freewire Broadband LLC Portland 06/01/2010 17915.00000 45-31-16.1 N OR MD WQKK324 122-40-46.9 W 0004266758 Freewire Broadband LLC Portland 06/01/2010 18065.00000 45-31-16.1 N CA MD WQLN619 118-13-32.2 W 0004266794 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 06/02/2010 19375.00000 33-56-04.2 N Page 35 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQLN619 118-13-32.2 W 0004266794 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 06/02/2010 19475.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004266794 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 06/02/2010 21875.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004266794 CLEARWIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298678A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298678A1.txt
  • Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQLN882 118-06-21.6 W 0004267949 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 06/02/2010 21825.00000 34-06-04.5 N CA MD WQLN882 118-06-21.6 W 0004267949 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 06/02/2010 21925.00000 34-06-04.5 N CA MD WQLN882 118-06-21.6 W 0004267949 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 06/02/2010 22075.00000 34-06-04.5 N CA MD WQLU926 117-56-04.2 W 0004267952 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 06/02/2010 19375.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004267952 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 06/02/2010 19475.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004267952 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 06/02/2010 19525.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004267952 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 06/02/2010 19625.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298679A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298679A1.txt
  • MD WLB383 095-33-25.1 W 0004269342 GTE MOBILNET OF SOUTH TEXAS LIMIHOUSTON 06/02/2010 06152.75000 29-35-48.5 N TX MD WLB383 095-33-25.1 W 0004269342 GTE MOBILNET OF SOUTH TEXAS LIMIHOUSTON 06/02/2010 06765.00000 29-35-48.5 N TX MD WLB383 095-33-25.1 W 0004269342 GTE MOBILNET OF SOUTH TEXAS LIMIHOUSTON 06/02/2010 06775.00000 29-35-48.5 N WA MD WQKV855 124-04-23.1 W 0004269343 Seattle SMSA Limited Partnership Forks 06/02/2010 10577.50000 48-05-04.2 N WA MD WPNB554 124-18-22.8 W 0004269344 Seattle SMSA Limited Partnership SAPPHO 06/02/2010 10616.25000 48-07-47.3 N WA MD WPNB554 124-18-22.8 W 0004269344 Seattle SMSA Limited Partnership SAPPHO 06/02/2010 10623.12500 48-07-47.3 N WA MD WPNB554 124-18-22.8 W 0004269344 Seattle SMSA Limited Partnership SAPPHO 06/02/2010 10638.12500 48-07-47.3 N WA MD WPNB554 124-18-22.8 W 0004269344 Seattle SMSA Limited Partnership SAPPHO 06/02/2010 10642.50000 48-07-47.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298680A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298680A1.txt
  • W 0004271421 CLEARWIRE SPECTRUM HOLDINGS IIISAINT JOSEPH 06/04/2010 17800.00000 45-33-59.0 N WI NE 091-24-11.0 W 0004271428 CLEARWIRE SPECTRUM HOLDINGS IIIChippewa Falls 06/04/2010 11265.00000 44-56-21.0 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR NE 123-08-35.0 W 0004271485 PORTLAND GENERAL ELECTRIC SALEM 06/04/2010 00932.39375 44-59-04.2 N OR NE 123-08-35.0 W 0004271485 PORTLAND GENERAL ELECTRIC SALEM 06/04/2010 00941.39375 44-59-04.2 N ID NE 116-34-24.0 W 0004271515 CLEARWIRE SPECTRUM HOLDINGS IIINampa 06/04/2010 23025.00000 43-31-34.0 N ID NE 116-36-34.0 W 0004271516 CLEARWIRE SPECTRUM HOLDINGS IIINampa 06/04/2010 21825.00000 43-32-35.0 N WA NE 122-26-52.8 W 0004271525 St. Anthony Hospital Tacoma 06/04/2010 11225.00000 47-14-43.0 N WA NE 122-36-10.2 W 0004271526 St. Anthony
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298838A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298838A1.txt
  • CINGULAR WIRELESS PCS, LLCELLENSBURG 06/09/2010 47-00-12.7 N WA MD KNKN211 121-30-00.4 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCENUMCLAW 06/09/2010 46-56-16.9 N WA MD KNKN211 119-34-23.1 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCEPHRATA 06/09/2010 47-19-11.8 N Page 25 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA MD KNKN211 119-57-04.2 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCGEORGE 06/09/2010 46-56-36.5 N WA MD KNKN211 121-34-46.1 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCGold Bar 06/09/2010 47-49-59.4 N WA MD KNKN211 119-01-07.3 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCGRAND COULEE 06/09/2010 47-56-53.3 N WA MD KNKN211 118-40-15.6 W 0004276615 NEW CINGULAR WIRELESS PCS, LLCLind 06/09/2010 46-47-35.2 N WA MD KNKN211 117-43-37.1 W 0004276615
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298933A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298933A1.txt
  • - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT MD WQHU227 113-21-59.9 W 0004284304 New Cingular Wireless PCS, LLC Leeds 06/15/2010 10632.50000 37-14-09.3 N UT MD WQHU227 113-21-59.9 W 0004284304 New Cingular Wireless PCS, LLC Leeds 06/15/2010 10735.00000 37-14-09.3 N NE MD WQHK994 098-31-04.2 W 0004285191 USCOC NEBRASKA/KANSAS, LLC Red Cloud 06/16/2010 06545.62500 40-10-29.1 N NE MD WQHK994 098-31-04.2 W 0004285191 USCOC NEBRASKA/KANSAS, LLC Red Cloud 06/16/2010 06585.00000 40-10-29.1 N TX MD WMT249 096-12-01.9 W 0004287661 TEXAS RSA 7B1 LIMITED PARTNERSHILEONARD 06/18/2010 06835.00000 33-22-38.3 N TX MD WPJA756 096-25-29.8 W 0004287675 AT&T Mobility Texas LLC WHITEWRIGHT 06/18/2010 05945.20000 33-30-30.0 N TX MD WPJA756 096-25-29.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298934A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298934A1.txt
  • NY RM WPGX803 077-30-28.0 W 0004286294 USA Mobility Wireless, Inc. IRONDEQUOIT 06/17/2010 00929.96250 43-10-54.2 N NY RM WPGX803 077-39-38.0 W 0004286294 USA Mobility Wireless, Inc. NORTH GREECE 06/17/2010 00929.96250 43-15-45.2 N NY RM WPGX803 073-42-20.4 W 0004286294 USA Mobility Wireless, Inc. NORTH GREENBUS 06/17/2010 00929.96250 42-41-23.3 N NY RM WPGX803 076-16-56.7 W 0004286294 USA Mobility Wireless, Inc. WARNERS 06/17/2010 00929.96250 43-06-04.2 N NY RM WPGX803 073-45-33.4 W 0004286294 USA Mobility Wireless, Inc. WARRENSBURG 06/17/2010 00929.96250 43-25-12.3 N CA RM WPHB451 118-16-31.3 W 0004286366 USA Mobility Wireless, Inc. GLENDALE 06/17/2010 00929.46250 34-12-52.0 N CA RM WPHB451 118-22-52.3 W 0004286366 USA Mobility Wireless, Inc. HOLLYWOOD 06/17/2010 00929.46250 34-06-30.0 N CA RM WPHB451 118-39-30.3 W 0004286366 USA Mobility Wireless, Inc. MALIBU 06/17/2010 00929.46250 34-04-35.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299052A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299052A1.txt
  • U.S. Federal Communications Commission Local Telephone Competition: Status as of December 31, 2008 28 Zero 17.4% 18.4% 17.7% 17.7% 17.7% 19.4% 18.3% 7.7% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 Ten or More 36.9 35.0 35.3 34.0 33.5 33.1 33.6 44.7 Zero 2.2% 2.4% 2.3% 2.4% 2.4%
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299297A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299297A1.txt
  • N PA MD WQMA410 080-00-22.7 W 0004295712 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 19525.00000 40-24-49.0 N PA MD WQMA410 080-00-22.7 W 0004295712 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 19625.00000 40-24-49.0 N PA MD WQMA410 080-00-22.7 W 0004295712 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 21975.00000 40-24-49.0 N PA MD WQMA410 080-00-22.7 W 0004295712 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 22075.00000 40-24-49.0 N PA MD WQMA503 079-51-04.2 W 0004295714 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 19375.00000 40-26-45.4 N PA MD WQMA503 079-51-04.2 W 0004295714 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 19475.00000 40-26-45.4 N PA MD WQMA503 079-51-04.2 W 0004295714 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 23075.00000 40-26-45.4 N PA MD WQMA503 079-51-04.2 W 0004295714 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/23/2010 23225.00000 40-26-45.4 N PA MD WQMA503 079-51-04.2 W 0004295714 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299299A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299299A1.txt
  • 0004291559 Multi Agency Communications Center Royal City 06/22/2010 06063.80000 46-57-45.8 N WA MD WQLH801 119-37-19.0 W 0004291559 Multi Agency Communications Center Royal City 06/22/2010 06197.24000 46-57-45.8 N WA MD WQLX635 119-32-51.8 W 0004291562 MULTI AGENCY COMMUNICATIONS CTSOAP LAKE 06/22/2010 05945.20000 47-27-09.7 N WA MD WQLX635 119-32-51.8 W 0004291562 MULTI AGENCY COMMUNICATIONS CTSOAP LAKE 06/22/2010 05974.85000 47-27-09.7 N WA MD WPNA314 119-20-04.2 W 0004291571 MULTI AGENCY COMMUNICATIONS CTMOSES LAKE 06/22/2010 05945.20000 47-10-51.4 N WA MD WPNA314 119-20-04.2 W 0004291571 MULTI AGENCY COMMUNICATIONS CTMOSES LAKE 06/22/2010 06123.10000 47-10-51.4 N WA MD WPNA314 119-20-04.2 W 0004291571 MULTI AGENCY COMMUNICATIONS CTMOSES LAKE 06/22/2010 06585.00000 47-10-51.4 N WA MD WPNA313 119-34-24.1 W 0004291575 MULTI AGENCY COMMUNICATIONS CTEPHRATA 06/22/2010 06286.19000 47-19-12.9 N WA MD WPNA313 119-34-24.1 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299557A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299557A1.txt
  • Limited PartnershipYucca Valley 06/28/2010 34-09-11.6 N NY MD KNKA738 073-29-03.8 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCArgyle 06/29/2010 43-11-12.0 N NY MD KNKA738 073-23-24.4 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCCAMBRIDGE 06/29/2010 43-04-59.4 N NY MD KNKA738 073-47-20.2 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCCHESTERTOWN 06/29/2010 43-38-47.4 N NY MD KNKA738 073-20-16.5 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCGRANVILLE 06/29/2010 43-20-04.2 N NY MD KNKA738 073-31-20.6 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCGREENWICH 06/29/2010 43-01-12.3 N NY MD KNKA738 074-02-57.4 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCJohnsburg 06/29/2010 43-40-20.3 N Page 22 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD KNKA738 073-45-28.0 W 0004302318 NEW CINGULAR WIRELESS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299558A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299558A1.txt
  • N CA MD WHJ741 117-37-23.1 W 0004304155 SOUTHERN CALIFORNIA EDISON COMCORONA 06/30/2010 10602.50000 33-47-54.0 N CA MD WHJ741 117-37-23.1 W 0004304155 SOUTHERN CALIFORNIA EDISON COMCORONA 06/30/2010 11325.00000 33-47-54.0 N CA MD WHJ741 117-37-23.1 W 0004304155 SOUTHERN CALIFORNIA EDISON COMCORONA 06/30/2010 17745.00000 33-47-54.0 N CA MD WHJ741 117-37-23.1 W 0004304155 SOUTHERN CALIFORNIA EDISON COMCORONA 06/30/2010 19360.00000 33-47-54.0 N CA MD WPOR717 118-00-04.2 W 0004305012 Los Angeles SMSA Limited Partnership WESTMINSTER 06/30/2010 10755.00000 33-44-46.0 N CA MD WPOR717 118-00-04.2 W 0004305012 Los Angeles SMSA Limited Partnership WESTMINSTER 06/30/2010 10995.00000 33-44-46.0 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPOR717 118-00-04.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299559A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299559A1.txt
  • 10855.00000 41-09-57.0 N Page 12 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT NE 111-58-23.1 W 0004306593 Verizon Wireless (VAW) LLC South Ogden 07/01/2010 11345.00000 41-11-33.2 N TX NE 095-31-18.1 W 0004306653 GTE Mobilnet of South Texas Limited PartHouston 07/01/2010 06063.80000 29-52-04.2 N PR NE 066-33-42.4 W 0004306768 T-MOBILE PUERTO RICO LLC Juana Diaz 07/01/2010 10835.00000 18-01-46.4 N ID NE 111-48-21.1 W 0004306776 Verizon Wireless (VAW) LLC Idaho Falls 07/01/2010 10835.00000 43-37-13.9 N NM NE 103-44-57.8 W 0004307182 T-MOBILE LICENSE LLC KENNA 07/02/2010 06126.18900 33-51-27.9 N NE NE 100-31-17.7 W 0004307853 USCOC NEBRASKA/KANSAS, LLC Curtis 07/02/2010 06615.00000 40-37-08.7 N NE NE 100-12-51.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299733A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299733A1.txt
  • N PA MD KNKA775 076-25-34.7 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCAirville 07/07/2010 39-50-07.0 N PA MD KNKA775 076-30-37.4 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCCRALEY 07/07/2010 39-57-01.4 N PA MD KNKA775 076-59-16.5 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCDILLSBURG 07/07/2010 40-05-33.3 N PA MD KNKA775 077-22-01.3 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCFairfield 07/07/2010 39-44-20.8 N PA MD KNKA775 077-27-04.2 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCFAYETTEVILLE 07/07/2010 39-54-20.3 N PA MD KNKA775 077-15-48.1 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCGettysburg 07/07/2010 39-45-49.0 N PA MD KNKA775 076-56-12.7 W 0004315238 NEW CINGULAR WIRELESS PCS, LLCHanover 07/07/2010 39-44-08.1 N Page 18 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299735A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299735A1.txt
  • Applicant Name Latitude City IL NE 087-57-03.3 W 0004317816 FiberTower Network Services Corp. Elk Grove Village 07/09/2010 10755.00000 42-02-02.3 N OR NE 118-27-19.7 W 0004317838 OREGON RSA #2, INC. Pendleton 07/09/2010 10662.50000 45-33-40.8 N AZ NE 110-47-27.7 W 0004317852 Peach Acquistions LLC Globe 07/09/2010 10775.00000 33-24-01.0 N OR NE 118-10-41.8 W 0004317861 OREGON RSA #2, INC. La Grande 07/09/2010 10642.50000 45-22-04.2 N AZ NE 110-46-42.5 W 0004318554 Abraham Divestiture Company LLC Globe 07/09/2010 11265.00000 33-25-29.8 N TX RM WMQ604 099-15-22.0 W 0004316958 TEXAS RSA 18 LIMITED PARTNERSHIPCOTULLA 07/08/2010 06123.10000 28-24-35.2 N TX RM WMQ604 099-15-22.0 W 0004316958 TEXAS RSA 18 LIMITED PARTNERSHIPCOTULLA 07/08/2010 06590.00000 28-24-35.2 N TX RM WMQ604 099-15-22.0 W 0004316958 TEXAS RSA 18 LIMITED PARTNERSHIPCOTULLA 07/08/2010 06650.00000 28-24-35.2 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299965A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299965A1.txt
  • 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-42-30.2 N Page 22 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KNKA341 117-06-17.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-42-33.2 N CA MD KNKA341 117-09-21.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-43-04.2 N CA MD KNKA341 117-13-49.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-43-18.2 N CA MD KNKA341 117-10-24.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-43-56.2 N CA MD KNKA341 117-09-33.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-44-46.2 N CA MD KNKA341 117-12-29.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 07/14/2010 32-44-53.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300379A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300379A1.txt
  • 0004328544 New Cingular Wireless PCS, LLC MARYVILLE 07/19/2010 40-22-00.1 N MO MD KNKN553 095-11-41.2 W 0004328544 New Cingular Wireless PCS, LLC MOUND CITY 07/19/2010 40-04-10.7 N MO MD KNKN553 095-11-41.9 W 0004328544 New Cingular Wireless PCS, LLC MOUND CITY 07/19/2010 40-04-14.0 N MO MD KNKN553 095-31-52.7 W 0004328544 New Cingular Wireless PCS, LLC Rockport 07/19/2010 40-24-27.1 N MO MD KNKN553 095-38-04.2 W 0004328544 New Cingular Wireless PCS, LLC Rockport 07/19/2010 40-34-13.4 N MO MD KNKN553 095-31-53.9 W 0004328544 New Cingular Wireless PCS, LLC ROCKPORT 07/19/2010 40-24-27.0 N MO MD KNKN553 095-17-55.7 W 0004328544 New Cingular Wireless PCS, LLC TARKIO 07/19/2010 40-26-07.7 N KS MD KNKN553 095-02-21.0 W 0004328544 New Cingular Wireless PCS, LLC TROY 07/19/2010 39-47-34.0 N ID MD KNKN253 116-23-26.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300380A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300380A1.txt
  • N MN MD WQLZ892 093-12-57.4 W 0004328984 CLEARWIRE SPECTRUM HOLDINGS IIIMinneapolis 07/20/2010 23375.00000 44-58-17.8 N MN MD WQLZ892 093-12-57.4 W 0004328984 CLEARWIRE SPECTRUM HOLDINGS IIIMinneapolis 07/20/2010 23425.00000 44-58-17.8 N MN MD WQLZ892 093-12-57.4 W 0004328984 CLEARWIRE SPECTRUM HOLDINGS IIIMinneapolis 07/20/2010 23525.00000 44-58-17.8 N MN MD WQLZ892 093-12-57.4 W 0004328984 CLEARWIRE SPECTRUM HOLDINGS IIIMinneapolis 07/20/2010 23575.00000 44-58-17.8 N MN MD WQLZ789 093-23-04.2 W 0004328987 CLEARWIRE SPECTRUM HOLDINGS IIISt. Louis Park 07/20/2010 17865.00000 44-56-30.0 N Page 31 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MN MD WQLZ789 093-23-04.2 W 0004328987 CLEARWIRE SPECTRUM HOLDINGS IIISt. Louis Park 07/20/2010 17965.00000 44-56-30.0 N MN MD WQLZ789 093-23-04.2 W 0004328987 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300668A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300668A1.txt
  • WIRELESS OF TEXAS RSA#HEMPHILL 07/28/2010 31-20-03.6 N TX MD KNKN538 094-47-22.7 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#LUFKIN 07/28/2010 31-19-23.9 N TX MD KNKN538 094-40-47.5 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#Nacogdoches 07/28/2010 31-48-49.6 N Page 2 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD KNKN538 094-49-04.2 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#NACOGDOCHES 07/28/2010 31-44-24.2 N TX MD KNKN538 093-56-29.7 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#PINELAND 07/28/2010 31-16-39.8 N TX MD KNKN538 094-49-03.8 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#Pollok 07/28/2010 31-26-02.0 N TX MD KNKN538 094-05-47.9 W 0004337657 CINGULAR WIRELESS OF TEXAS RSA#SAN AUGUSTINE 07/28/2010 31-32-49.4 N TX MD KNKN538 094-14-37.1 W 0004337657 CINGULAR
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300669A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300669A1.txt
  • WIRELESS PCS, LLCRIDGECREST 07/27/2010 35-28-40.3 N Page 20 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KNKA351 117-38-01.5 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 07/27/2010 35-37-17.2 N CA MD KNKA351 114-09-56.1 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN BERNARDINO 07/27/2010 34-18-33.7 N CA MD KNKA351 117-36-04.2 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 07/27/2010 33-24-36.4 N CA MD KNKA351 117-36-59.2 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 07/27/2010 33-25-49.3 N CA MD KNKA351 117-37-18.3 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 07/27/2010 33-26-25.9 N CA MD KNKA351 117-35-36.8 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 07/27/2010 33-27-18.1 N CA MD KNKA351 117-35-02.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300768A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300768A1.txt
  • of Washington, Inc. 158.34000000 -- -- 7 1 07/06/2010 KGN894 FB2 CenturyTel of Washington, Inc. 151.98500000 LONG BEACH 46-21-9.0 N WA 124-3-9.0 W 8 1 07/06/2010 KGN894 MO CenturyTel of Washington, Inc. 151.98500000 -- -- 9 1 07/06/2010 KGN894 MO CenturyTel of Washington, Inc. 158.34000000 -- -- 9 1 07/07/2010 WNDN322 FB2 SYCAMORE COMMUNITY UNIT SCHOOL DIST 4 452.22500000 SYCAMORE 42-1-4.2 N IL 88-39-44.8 W 3 1 07/07/2010 WNDN322 MO SYCAMORE COMMUNITY UNIT SCHOOL DIST 4 452.22500000 -- -- 4 1 07/07/2010 WNDN322 MO SYCAMORE COMMUNITY UNIT SCHOOL DIST 4 457.22500000 -- -- 4 1 07/06/2010 WPGM762 FXO HAWAII ELECTRIC LIGHT COMPANY INC 452.17500000 HILO 19-42-13.1 N HI 155-3-36.0 W 1 2 07/06/2010 WPGM762 FXO HAWAII ELECTRIC LIGHT COMPANY INC 457.17500000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300783A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300783A1.txt
  • N GA MD KNKN765 085-21-33.1 W 0004347133 Georgia RSA No.3 Limited Partnership Cave Springs 08/06/2010 34-06-14.1 N GA MD KNKN765 085-13-42.5 W 0004347133 Georgia RSA No.3 Limited Partnership Cedartown 08/06/2010 33-54-36.0 N GA MD KNKN765 085-17-36.8 W 0004347133 Georgia RSA No.3 Limited Partnership CEDARTOWN 08/06/2010 34-00-05.4 N GA MD KNKN765 084-46-19.9 W 0004347133 Georgia RSA No.3 Limited Partnership EMERSON 08/06/2010 34-07-04.2 N Page 39 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA MD KNKN765 085-00-45.2 W 0004347133 Georgia RSA No.3 Limited Partnership ROCKMART 08/06/2010 33-58-41.0 N GA MD KNKN765 085-21-29.2 W 0004347133 Georgia RSA No.3 Limited Partnership Rome 08/06/2010 34-15-21.6 N GA MD KNKN765 085-13-51.8 W 0004347133 Georgia
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.txt
  • for Determining Proposed Regional PSAPs in Oklahoma...................................................12 3.5.2 PSAP Regionalization Example: South West Oklahoma Regional 9- 1-1 Association.....................13 3.5.3 Proposed Regi onal PSAPs........................................................................................................ ......16 3.5.4 Regional PSAPs Map............................................................................................................. .........20 3.5.5 Oklahoma E9-1-1 Implement ation/Upgrade Summary....................................................................21 3.5.6 High-Level Tasks for Regionalizing and Im plementing E9-1-1........................................................29 4. OTHER E9-1-1 ISSUES AND RECOMMENDATIONS........................................................................................ 31 4.1 E9-1-1 AND THE AMERICANS WITH DISABILITIES ACT (ADA)..............................................................................31 4.2 E9-1-1 AND MULTI-LINE TELEPHONE SYSTEMS (MLTS)....................................................................................31 4.3 E9-1-1 AND THE OKLAHOMA HIGHWAY PATROL FIELD TROOP COMMUNICATION CENTERS.................................33 4.4 E9-1-1 IN RELATION TO DEPARTMENT OF HOMELAND SECURITY PROGRAMS .....................................................34 4.4.1 Radio Intero perability......................................................................................................... ..............34 4.4.2 Next Generation 9-1-1 (NG9-1-1)....................................................................................................34 4.4.3 Evolution to a Next Generation 9-1-1 Syst em.................................................................................35 4.4.4 Next Generation 9-1-1 Benefits................................................................................................. ......35 4.4.5 Leveraging Existing Oklaho ma Assets for
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300961A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300961A1.txt
  • 46-03-12.0 N MN MD KNKN375 095-54-15.4 W 0004349829 New Cingular Wireless PCS, LLC Morris 08/10/2010 45-37-15.8 N MN MD KNKN375 094-39-04.0 W 0004349829 New Cingular Wireless PCS, LLC Motley 08/10/2010 46-33-08.0 N MN MD KNKN375 094-39-13.0 W 0004349829 New Cingular Wireless PCS, LLC MOTLEY 08/10/2010 46-16-36.0 N MN MD KNKN375 096-26-42.9 W 0004349829 New Cingular Wireless PCS, LLC ORTONVILLE 08/10/2010 45-19-04.2 N MN MD KNKN375 095-21-24.5 W 0004349829 New Cingular Wireless PCS, LLC Osage 08/10/2010 46-53-52.8 N MN MD KNKN375 095-05-57.0 W 0004349829 New Cingular Wireless PCS, LLC PARK RAPIDS 08/10/2010 46-49-16.0 N MN MD KNKN375 096-05-40.1 W 0004349829 New Cingular Wireless PCS, LLC Pelican Rapids 08/10/2010 46-42-09.1 N MN MD KNKN375 096-05-36.0 W 0004349829 New Cingular Wireless PCS, LLC PELICAN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300962A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300962A1.txt
  • 08/13/2010 06740.00000 45-23-56.6 N OR MD WQKD357 117-23-20.5 W 0004352921 RCC Minnesota, Inc. Enterprise 08/13/2010 06740.62500 45-23-56.6 N OR MD WQKD360 117-31-31.7 W 0004352922 RCC Minnesota, Inc. WALLOWA 08/13/2010 06560.00000 45-34-42.4 N OR MD WQKD360 117-31-31.7 W 0004352922 RCC Minnesota, Inc. WALLOWA 08/13/2010 06560.62500 45-34-42.4 N GA MD WPNG867 082-37-03.7 W 0004352927 New Cingular Wireless PCS, LLC MILLWOOD 08/13/2010 05945.20000 31-16-04.2 N GA MD WPNG867 082-37-03.7 W 0004352927 New Cingular Wireless PCS, LLC MILLWOOD 08/13/2010 06315.84000 31-16-04.2 N GA MD WPNG867 082-37-03.7 W 0004352927 New Cingular Wireless PCS, LLC MILLWOOD 08/13/2010 06745.00000 31-16-04.2 N GA MD WPQS335 082-18-30.9 W 0004352947 New Cingular Wireless PCS, LLC WAYCROSS 08/13/2010 06063.80000 31-15-46.3 N GA MD WPQS335 082-18-30.9 W 0004352947 New Cingular Wireless PCS, LLC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301113A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301113A1.txt
  • City RO WPIA886 0004354745 THOMPSON, STEPHEN A 08/16/2010 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RM KIN339 A 0004354534 NEPSK, INC. 08/16/2010 00461.50000 RM KIN339 A 0004354534 NEPSK, INC. 08/16/2010 00466.50000 ME RM KIN339 067-48-33.1 W 0004354534 NEPSK, INC. MARS HILL 08/16/2010 00461.50000 46-33-04.2 N ME RM KIN339 068-00-05.1 W 0004354534 NEPSK, INC. PRESQUE ISLE 08/16/2010 00466.50000 46-43-44.2 N Page 21 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RM WNUD923 A 0004354940 VandenBos, Bruce a 08/16/2010 00463.92500 RM WNUD923 A 0004354940 VandenBos, Bruce a 08/16/2010 00468.92500 SD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301114A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301114A1.txt
  • MN MD KNKQ409 094-18-24.0 W 0004360439 New Cingular Wireless PCS, LLC NORTHOME 08/20/2010 47-52-15.0 N MN MD KNKQ409 093-04-40.1 W 0004360439 New Cingular Wireless PCS, LLC RAY 08/20/2010 48-26-57.9 N MN MD KNKQ409 093-02-09.5 W 0004360439 New Cingular Wireless PCS, LLC SIDE LAKE 08/20/2010 47-38-25.5 N MN MD KNKQ409 094-07-45.4 W 0004360439 New Cingular Wireless PCS, LLC Squaw Lake 08/20/2010 47-36-04.2 N MN MD KNKQ409 093-17-15.6 W 0004360439 New Cingular Wireless PCS, LLC Warba 08/20/2010 47-08-09.7 N OH MD KNKN713 081-27-49.7 W 0004360453 New Cingular Wireless PCS, LLC Bolivar 08/20/2010 40-37-25.9 N OH MD KNKN713 080-59-07.0 W 0004360453 New Cingular Wireless PCS, LLC CADIZ 08/20/2010 40-17-44.0 N OH MD KNKN713 081-29-06.4 W 0004360453 New Cingular Wireless PCS, LLC Caldwell 08/20/2010 39-41-15.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301115A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301115A1.txt
  • PCS, LLCPONCA CITY 08/19/2010 36-39-53.1 N OK MD KNKA356 095-04-59.8 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSALINA 08/19/2010 36-20-09.0 N OK MD KNKA356 096-11-56.6 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSapulpa 08/19/2010 35-58-41.0 N OK MD KNKA356 096-10-27.0 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSAPULPA 08/19/2010 35-58-35.3 N OK MD KNKA356 096-02-46.2 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSKIATOOK 08/19/2010 36-23-04.2 N OK MD KNKA356 096-07-30.4 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSKIATOOK 08/19/2010 36-24-13.7 N OK MD KNKA356 096-37-02.4 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSTROUD 08/19/2010 35-46-12.1 N OK MD KNKA356 096-37-05.1 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSTROUD 08/19/2010 35-46-13.2 N OK MD KNKA356 095-50-20.0 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCTulsa 08/19/2010 36-22-46.3 N OK MD KNKA356
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301116A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301116A1.txt
  • IIINatick 08/19/2010 23025.00000 42-17-49.3 N MA MD WQMC480 071-05-37.4 W 0004358855 CLEARWIRE SPECTRUM HOLDINGS IIIBoston 08/19/2010 10735.00000 42-16-43.5 N MA MD WQMC480 071-05-37.4 W 0004358855 CLEARWIRE SPECTRUM HOLDINGS IIIBoston 08/19/2010 19425.00000 42-16-43.5 N Page 23 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WQMA478 079-59-04.2 W 0004358865 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 08/19/2010 18015.00000 40-21-55.9 N PA MD WQMA478 079-59-04.2 W 0004358865 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 08/19/2010 18115.00000 40-21-55.9 N PA MD WQMA478 079-59-04.2 W 0004358865 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 08/19/2010 22425.00000 40-21-55.9 N PA MD WQMA478 079-59-04.2 W 0004358865 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 08/19/2010 23025.00000 40-21-55.9 N PA MD WQMA478 079-59-04.2 W 0004358865 CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301228A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301228A1.txt
  • Limited Partnership Kissimee 08/26/2010 28-15-11.0 N FL AM KNKA253 081-31-40.3 W 0004277286 Orlando SMSA Limited Partnership KISSIMEE 08/26/2010 28-20-15.0 N FL AM KNKA253 081-35-15.8 W 0004277286 Orlando SMSA Limited Partnership Kissimmee 08/26/2010 28-17-00.9 N FL AM KNKA253 080-51-51.5 W 0004277286 Orlando SMSA Limited Partnership KISSIMMEE 08/26/2010 28-05-19.7 N FL AM KNKA253 081-22-30.4 W 0004277286 Orlando SMSA Limited Partnership KISSIMMEE 08/26/2010 28-08-04.2 N FL AM KNKA253 081-27-23.0 W 0004277286 Orlando SMSA Limited Partnership KISSIMMEE 08/26/2010 28-10-59.8 N Page 16 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL AM KNKA253 081-27-53.1 W 0004277286 Orlando SMSA Limited Partnership KISSIMMEE 08/26/2010 28-11-49.5 N FL AM KNKA253 081-34-59.6 W 0004277286 Orlando SMSA Limited
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301229A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301229A1.txt
  • N TX MD WQLL690 096-48-06.6 W 0004363415 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 08/24/2010 22125.00000 32-46-52.4 N TX MD WQLL690 096-48-06.6 W 0004363415 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 08/24/2010 22175.00000 32-46-52.4 N TX MD WQLL690 096-48-06.6 W 0004363415 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 08/24/2010 22225.00000 32-46-52.4 N TX MD WQLL690 096-48-06.6 W 0004363415 CLEARWIRE SPECTRUM HOLDINGS IIIDallas 08/24/2010 22275.00000 32-46-52.4 N TX MD WQLD953 097-07-04.2 W 0004363417 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 08/24/2010 10735.00000 32-36-16.1 N Page 24 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WQLD953 097-07-04.2 W 0004363417 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 08/24/2010 10855.00000 32-36-16.1 N TX MD WQLD953 097-07-04.2 W 0004363417 CLEARWIRE SPECTRUM HOLDINGS IIIMansfield 08/24/2010 17815.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301230A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301230A1.txt
  • 39-51-05.2 N OH MD KNKA550 080-56-18.3 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCST. CLAIRSVILLE 08/26/2010 40-04-55.3 N WV MD KNKA550 080-31-40.3 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCVALLEY GROVE 08/26/2010 40-05-49.3 N WV MD KNKA550 080-31-40.7 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCVALLEY GROVE 08/26/2010 40-05-49.6 N WV MD KNKA550 080-35-57.9 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCWest Liberty 08/26/2010 40-10-04.2 N WV MD KNKA550 080-38-21.3 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCWHEELING 08/26/2010 40-02-22.3 N Page 7 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WV MD KNKA550 080-41-44.3 W 0004367856 NEW CINGULAR WIRELESS PCS, LLCWHEELING 08/26/2010 40-06-17.3 N RO KNKQ409 0004364093 New Cingular Wireless PCS, LLC 08/24/2010
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301232A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301232A1.txt
  • Jo Carroll Energy, Inc Morrison, IL 08/27/2010 11285.00000 41-50-16.0 N GA NE 084-31-20.0 W 0004368489 CLEARWIRE SPECTRUM HOLDINGS IIISmyrna 08/27/2010 21975.00000 33-50-56.0 N GA NE 084-21-32.1 W 0004368494 CLEARWIRE SPECTRUM HOLDINGS IIIAtlanta 08/27/2010 21925.00000 33-54-31.4 N GA NE 084-10-04.5 W 0004368499 CLEARWIRE SPECTRUM HOLDINGS IIIMcDonough 08/27/2010 21875.00000 33-26-15.3 N GA NE 084-21-59.9 W 0004368522 CLEARWIRE SPECTRUM HOLDINGS IIIAtlanta 08/27/2010 11345.00000 33-52-04.2 N GA NE 084-16-08.3 W 0004368524 CLEARWIRE SPECTRUM HOLDINGS IIIAvondale Estates 08/27/2010 23025.00000 33-45-35.3 N GA NE 083-59-52.7 W 0004368530 CLEARWIRE SPECTRUM HOLDINGS IIILawrenceville 08/27/2010 22025.00000 33-56-44.0 N GA NE 084-23-47.9 W 0004368535 CLEARWIRE SPECTRUM HOLDINGS IIIAtlanta 08/27/2010 17815.00000 33-44-39.4 N GA NE 084-23-47.9 W 0004368535 CLEARWIRE SPECTRUM HOLDINGS IIIAtlanta 08/27/2010 17915.00000 33-44-39.4 N GA NE 084-23-47.9 W 0004368535 CLEARWIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301294A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301294A1.txt
  • 4.3 North Dakota 82.3 70.5 51.5 29.9 27.8 Northern Mariana Isl * * * * * Ohio 79.3 70.1 42.8 31.2 5.2 Oklahoma 89.7 84.3 37.4 25.3 3.1 Oregon 89.1 81.1 49.0 38.7 6.7 Pennsylvania 82.4 74.9 53.8 36.4 11.7 Puerto Rico 94.7 73.3 12.9 0.6 0.0 Rhode Island 87.0 81.2 61.4 51.8 51.2 South Carolina 76.4 68.5 45.4 22.7 4.2 South Dakota 78.0 67.2 53.1 34.0 31.3 Tennessee 81.3 71.4 43.8 26.7 2.7 Texas 86.4 77.0 33.8 20.9 5.6 Utah 88.4 77.9 38.4 32.3 3.5 Vermont 76.8 71.0 60.5 39.0 4.1 Virgin Islands 79.1 46.1 * * * Virginia 81.7 70.7 50.2 37.9 22.5 Washington 87.7 80.0 47.7 41.3 7.4 West Virginia 85.6 76.7 45.8 29.4 2.0 Wisconsin 87.1 78.3
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301310A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301310A1.txt
  • State U.S. Federal Communications Commission Local Telephone Competition: Status as of June 30, 2009 28 Zero 17.4%18.4%17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 10.1 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 7.9 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 6.1 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 5.4 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 4.6 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 4.0 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 3.4 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 3.1 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 2.6 Ten or More 36.9 35.0 35.3 34.0 33.5 33.1 33.6 44.7 44.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301340A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301340A1.txt
  • KNKA351 118-23-32.1 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCRANCHO PALOS V 08/31/2010 33-45-48.6 N CA AM KNKA351 117-42-00.6 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 08/31/2010 35-28-40.3 N CA AM KNKA351 117-38-01.5 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 08/31/2010 35-37-17.2 N CA AM KNKA351 114-09-56.1 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN BERNARDINO 08/31/2010 34-18-33.7 N CA AM KNKA351 117-36-04.2 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 08/31/2010 33-24-36.4 N CA AM KNKA351 117-36-59.2 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 08/31/2010 33-25-49.3 N CA AM KNKA351 117-37-18.3 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 08/31/2010 33-26-25.9 N CA AM KNKA351 117-35-36.8 W 0004336898 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 08/31/2010 33-27-18.1 N CA AM KNKA351 117-35-02.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301341A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301341A1.txt
  • 088-29-30.2 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCPADUCAH 09/03/2010 36-59-45.6 N Page 14 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY AM KNKN830 088-40-31.6 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCPADUCAH 09/03/2010 37-05-07.8 N KY AM KNKN830 088-38-04.8 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCPADUCAH HOSPITA 09/03/2010 37-04-04.2 N KY AM KNKN830 088-35-22.0 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCSedalia 09/03/2010 36-33-30.0 N KY AM KNKN830 088-47-03.8 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCWest Paducah 09/03/2010 37-05-48.0 N KY AM KNKN830 089-04-57.4 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCWICKLIFFE 09/03/2010 36-57-02.0 N KY AM KNKN830 088-47-03.9 W 0004315256 NEW CINGULAR WIRELESS PCS, LLCWingo 09/03/2010 36-36-41.4 N TX AM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301456A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301456A1.txt
  • 32-41-49.2 N CA AM KNKA341 117-14-56.4 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-42-28.6 N CA AM KNKA341 117-09-50.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-42-30.2 N CA AM KNKA341 117-06-17.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-42-33.2 N CA AM KNKA341 117-09-21.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-43-04.2 N CA AM KNKA341 117-13-49.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-43-18.2 N Page 18 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KNKA341 117-10-24.1 W 0004322983 NEW CINGULAR WIRELESS PCS, LLCSAN DIEGO 09/09/2010 32-43-56.2 N CA AM KNKA341 117-09-33.1 W 0004322983 NEW
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301505A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301505A1.txt
  • . . . .. . . . . . . . 202 208 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2008. . . . . . . . . . . . . . . . . . . . . . . . . . . . . Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008. . . . . . .
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301621A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301621A1.txt
  • 32-12-51.1 N GA MD KNKN706 082-20-18.7 W 0004388631 New Cingular Wireless PCS, LLC LYONS 09/14/2010 32-03-21.8 N GA MD KNKN706 082-00-58.8 W 0004388631 New Cingular Wireless PCS, LLC MANASSAS 09/14/2010 32-08-43.4 N GA MD KNKN706 082-34-52.5 W 0004388631 New Cingular Wireless PCS, LLC MANOR 09/14/2010 31-06-03.0 N GA MD KNKN706 082-37-03.7 W 0004388631 New Cingular Wireless PCS, LLC MILLWOOD 09/14/2010 31-16-04.2 N GA MD KNKN706 082-00-18.3 W 0004388631 New Cingular Wireless PCS, LLC Nahunta 09/14/2010 31-12-29.7 N GA MD KNKN706 081-58-12.4 W 0004388631 New Cingular Wireless PCS, LLC Reidsville 09/14/2010 32-05-48.7 N GA MD KNKN706 082-05-10.1 W 0004388631 New Cingular Wireless PCS, LLC ST. GEORGE 09/14/2010 30-31-18.0 N GA MD KNKN706 082-25-35.5 W 0004388631 New Cingular Wireless PCS, LLC VIDALIA 09/14/2010
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301622A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301622A1.txt
  • 00468.82500 MI RM WPIJ821 085-39-55.1 W 0004388693 T & W ELECTRONICS INC GRAND RAPIDS 09/14/2010 00463.82500 42-58-58.1 N RO WNHI309 0004389672 Schuylkill Mobile Fone, Inc. 09/15/2010 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR AM WQML640 123-08-35.0 W 0004271485 PORTLAND GENERAL ELECTRIC SALEM 09/15/2010 00932.39375 44-59-04.2 N OR AM WQML640 123-08-35.0 W 0004271485 PORTLAND GENERAL ELECTRIC SALEM 09/15/2010 00941.39375 44-59-04.2 N PA AM WQMA464 080-01-13.3 W 0004297944 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 09/14/2010 11465.00000 40-27-03.3 N PA AM WQMA464 080-01-13.3 W 0004297944 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 09/14/2010 11545.00000 40-27-03.3 N PA AM WQMA464 080-01-13.3 W 0004297944 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 09/14/2010 18015.00000 40-27-03.3 N PA AM WQMA464
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301765A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301765A1.txt
  • RO WPIG304 0004394446 USA Mobility Wireless, Inc. 09/20/2010 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AM KIN339 A 0004354534 NEPSK, INC. 09/21/2010 00461.50000 AM KIN339 A 0004354534 NEPSK, INC. 09/21/2010 00466.50000 ME AM KIN339 067-48-33.1 W 0004354534 NEPSK, INC. MARS HILL 09/21/2010 00461.50000 46-33-04.2 N Page 23 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ME AM KIN339 068-00-05.1 W 0004354534 NEPSK, INC. PRESQUE ISLE 09/21/2010 00466.50000 46-43-44.2 N MD WPBP417 A 0004394651 SAIA COMMUNICATIONS INC. 09/21/2010 00151.92500 NY MD WPBP417 078-48-44.1 W 0004394651 SAIA COMMUNICATIONS INC. HAMBURG
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301766A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301766A1.txt
  • 118-06-21.6 W 0004396180 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 09/22/2010 19375.00000 34-06-04.5 N CA MD WQLN882 118-06-21.6 W 0004396180 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 09/22/2010 21825.00000 34-06-04.5 N CA MD WQLN882 118-06-21.6 W 0004396180 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 09/22/2010 21925.00000 34-06-04.5 N CA MD WQLN882 118-06-21.6 W 0004396180 CLEARWIRE SPECTRUM HOLDINGS IIISan Gabriel 09/22/2010 22075.00000 34-06-04.5 N CA MD WQLU926 117-56-04.2 W 0004396182 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 09/22/2010 19375.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004396182 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 09/22/2010 19475.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004396182 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 09/22/2010 19525.00000 34-03-29.6 N CA MD WQLU926 117-56-04.2 W 0004396182 CLEARWIRE SPECTRUM HOLDINGS IIIWest Covina 09/22/2010 19625.00000 34-03-29.6 N Page 22 MG -
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301823A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301823A1.txt
  • 143,342 2.8 142,367 2.0 1993 148,106 3.3 147,033 3.3 1994 153,448 3.6 151,543 3.1 1995 159,659 4.0 158,153 4.4 1996 166,446 4.3 165,350 4.6 1997 173,867 4.5 173,857 5.1 1998 179,849 3.4 180,516 3.8 1999 189,397 185,003 2.9 186,594 3.4 2000 192,432 1.6% 188,500 1.9 187,581 0.5 2001 191,571 -0.4 185,587 -1.5 179,811 -4.1 2002 189,250 -1.2 180,095 -3.0 172,246 -4.2 2003 182,933 -3.3 173,141 -3.9 161,374 -6.3 2004 177,691 -2.9 165,980 -4.1 154,039 -4.5 2005 175,161 -1.4 157,038 -5.4 147,993 -3.9 2006 167,460 -4.4 146,843 -6.5 140,029 -5.4 2007 158,437 -5.4 135,790 -7.5 131,586 -6.0 2008 162,627 2.6 122,597 -9.7 121,675 -7.5 1 Includes end-user switched access lines for competitive local exchange carriers (CLECs) and incumbent local exchange carrier (ILECs)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301909A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301909A1.txt
  • WIRELESS PCS, LLCWILDWOOD 09/28/2010 28-54-07.6 N NY AM KNKA738 073-29-03.8 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCArgyle 09/29/2010 43-11-12.0 N NY AM KNKA738 073-23-24.4 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCCAMBRIDGE 09/29/2010 43-04-59.4 N NY AM KNKA738 073-47-20.2 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCCHESTERTOWN 09/29/2010 43-38-47.4 N NY AM KNKA738 073-20-16.5 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCGRANVILLE 09/29/2010 43-20-04.2 N Page 9 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY AM KNKA738 073-31-20.6 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCGREENWICH 09/29/2010 43-01-12.3 N NY AM KNKA738 074-02-57.4 W 0004302318 NEW CINGULAR WIRELESS PCS, LLCJohnsburg 09/29/2010 43-40-20.3 N NY AM KNKA738 073-45-28.0 W 0004302318 NEW CINGULAR WIRELESS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301910A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301910A1.txt
  • City RO WPIT653 0004403631 R Comm wireless 09/28/2010 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AM KIN339 A 0004354534 NEPSK, INC. 09/30/2010 00461.50000 AM KIN339 A 0004354534 NEPSK, INC. 09/30/2010 00466.50000 ME AM KIN339 067-48-33.1 W 0004354534 NEPSK, INC. MARS HILL 09/30/2010 00461.50000 46-33-04.2 N ME AM KIN339 068-00-05.0 W 0004354534 NEPSK, INC. PRESQUE ISLE 09/30/2010 00466.50000 46-43-44.0 N ND RM WNUJ864 103-40-26.7 W 0004403536 KOHLER, DENNIS D ALEXANDER 09/28/2010 00152.48000 47-56-20.1 N ND RM WNUJ864 102-43-59.7 W 0004403536 KOHLER, DENNIS D DICKINSON 09/28/2010 00464.80000 46-55-17.0 N ND RM WNUJ864 102-54-49.7 W 0004403536 KOHLER, DENNIS D KEENE 09/28/2010 00152.48000 48-04-10.1 N ND RM WNUJ864
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302101A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302101A1.txt
  • 46-03-12.0 N MN AM KNKN375 095-54-15.4 W 0004349829 New Cingular Wireless PCS, LLC Morris 10/04/2010 45-37-15.8 N MN AM KNKN375 094-39-04.0 W 0004349829 New Cingular Wireless PCS, LLC Motley 10/04/2010 46-33-08.0 N MN AM KNKN375 094-39-13.0 W 0004349829 New Cingular Wireless PCS, LLC MOTLEY 10/04/2010 46-16-36.0 N MN AM KNKN375 096-26-42.9 W 0004349829 New Cingular Wireless PCS, LLC ORTONVILLE 10/04/2010 45-19-04.2 N MN AM KNKN375 095-21-24.5 W 0004349829 New Cingular Wireless PCS, LLC Osage 10/04/2010 46-53-52.8 N MN AM KNKN375 095-05-57.0 W 0004349829 New Cingular Wireless PCS, LLC PARK RAPIDS 10/04/2010 46-49-16.0 N MN AM KNKN375 096-05-40.1 W 0004349829 New Cingular Wireless PCS, LLC Pelican Rapids 10/04/2010 46-42-09.1 N MN AM KNKN375 096-05-36.0 W 0004349829 New Cingular Wireless PCS, LLC PELICAN
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302103A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302103A1.txt
  • WQJR838 093-00-54.0 W 0004415938 Telecom Transport Management, Inc. St. Paul 10/08/2010 21485.00000 44-56-47.0 N MN MD WQJR838 093-00-54.0 W 0004415938 Telecom Transport Management, Inc. St. Paul 10/08/2010 22110.00000 44-56-47.0 N MN MD WQJR838 093-00-54.0 W 0004415938 Telecom Transport Management, Inc. St. Paul 10/08/2010 22125.00000 44-56-47.0 N MN MD WQJW504 093-00-30.6 W 0004415943 Telecom Transport Management, Inc. St. Paul 10/08/2010 22510.00000 44-56-04.2 N MN MD WQJW503 093-01-38.7 W 0004415949 Telecom Transport Management, Inc. St. Paul 10/08/2010 22685.00000 44-57-11.7 N MN MD WQJW578 093-08-44.5 W 0004415952 Telecom Transport Management, Inc. St. Paul 10/08/2010 21360.00000 44-54-45.7 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302270A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302270A1.txt
  • 37-21-53.2 N CA MD WQML812 121-58-58.0 W 0004416607 CLEARWIRE SPECTRUM HOLDINGS IIISanta Clara 10/12/2010 21975.00000 37-21-53.2 N CA MD WQML812 121-58-58.0 W 0004416607 CLEARWIRE SPECTRUM HOLDINGS IIISanta Clara 10/12/2010 22025.00000 37-21-53.2 N CA MD WQML812 121-58-58.0 W 0004416607 CLEARWIRE SPECTRUM HOLDINGS IIISanta Clara 10/12/2010 22075.00000 37-21-53.2 N CA MD WQMM324 121-47-05.1 W 0004416608 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/12/2010 23075.00000 37-18-04.2 N CA MD WQMM324 121-47-05.1 W 0004416608 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/12/2010 23225.00000 37-18-04.2 N AZ MD WQML691 109-09-56.2 W 0004416612 Transworld Network, Corp. Alpine 10/12/2010 06123.10000 33-49-36.1 N AZ MD WQML691 109-09-56.2 W 0004416612 Transworld Network, Corp. Alpine 10/12/2010 06315.84000 33-49-36.1 N NM MD WHK774 104-35-46.9 W 0004416676 Tri State Generation & Transmission AssoSPRINGER 10/12/2010 00953.95000 36-23-53.1 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302271A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302271A1.txt
  • 37-28-46.6 N CA MD WQLY843 122-15-18.0 W 0004421399 CLEARWIRE SPECTRUM HOLDINGS IIIRedwood City 10/14/2010 18065.00000 37-28-46.6 N CA MD WQLY843 122-15-18.0 W 0004421399 CLEARWIRE SPECTRUM HOLDINGS IIIRedwood City 10/14/2010 23375.00000 37-28-46.6 N CA MD WQLY843 122-15-18.0 W 0004421399 CLEARWIRE SPECTRUM HOLDINGS IIIRedwood City 10/14/2010 23475.00000 37-28-46.6 N CA MD WQML875 122-07-47.7 W 0004421400 CLEARWIRE SPECTRUM HOLDINGS IIIPalo Alto 10/14/2010 21925.00000 37-26-04.2 N CA MD WQML875 122-07-47.7 W 0004421400 CLEARWIRE SPECTRUM HOLDINGS IIIPalo Alto 10/14/2010 22075.00000 37-26-04.2 N Page 40 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQKU514 122-04-19.7 W 0004421401 CLEARWIRE SPECTRUM HOLDINGS IIImountain View 10/14/2010 18015.00000 37-25-36.4 N CA MD WQKU514 122-04-19.7 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302400A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302400A1.txt
  • W 0004428011 CLEARWIRE SPECTRUM HOLDINGS IIICINCINNATI 10/21/2010 23225.00000 39-07-27.0 N Page 18 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO NE 089-31-20.3 W 0004428335 KBSI Licensee, LP Cape Girardeau 10/21/2010 10705.00000 37-18-20.1 N MO NE 089-33-30.3 W 0004428337 KBSI Licensee, LP Cape Girardeau 10/21/2010 11205.00000 37-17-04.2 N CA NE 118-35-48.1 W 0004428354 Nextweb Inc Chatsworth 10/21/2010 23175.00000 34-14-56.0 N CO NE 104-44-00.7 W 0004428438 Open Range Communications Greeley 10/21/2010 23080.00000 40-25-26.2 N CO NE 104-46-18.9 W 0004428439 Open Range Communications Greeley 10/21/2010 21830.00000 40-25-20.7 N CO NE 104-41-57.2 W 0004428441 Open Range Communications Greeley 10/21/2010 22080.00000 40-24-12.3 N WA NE 122-23-01.5 W 0004428500 Accel Net, Inc.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302402A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302402A1.txt
  • 10895.00000 34-47-49.0 N NC NE 077-24-02.0 W 0004425453 Onslow Water and Sewer Authority Jacksonville 10/19/2010 10935.00000 34-47-49.0 N NC NE 077-24-02.0 W 0004425453 Onslow Water and Sewer Authority Jacksonville 10/19/2010 10975.00000 34-47-49.0 N NC NE 077-26-55.3 W 0004425454 Onslow Water and Sewer Authority SNEADS FERRY 10/19/2010 11465.00000 34-33-34.1 N MO NE 094-22-44.4 W 0004425456 MID-AMERICA REGIONAL COUNCIL EMHarrisonville 10/19/2010 06315.84000 38-42-04.2 N MO NE 094-22-44.4 W 0004425456 MID-AMERICA REGIONAL COUNCIL EMHarrisonville 10/19/2010 06345.49000 38-42-04.2 N CA NE 117-30-09.2 W 0004425890 CALIFORNIA, STATE OF FONTANA 10/19/2010 06805.00000 34-07-45.0 N GA NE 084-23-25.7 W 0004426454 Atlanta Police Department Atlanta 10/19/2010 17765.00000 33-44-56.4 N TX NE 096-46-21.2 W 0004426491 City of Plano Plano 10/19/2010 19360.00000 33-02-32.8 N TX NE 096-46-21.2 W 0004426491 City of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302708A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302708A1.txt
  • KCO31 074-12-35.5 W 0004444439 New Jersey Turnpike Authority DOVER TOWNSHIP 11/05/2010 06093.45000 39-59-17.4 N NJ MD KCO31 074-12-35.5 W 0004444439 New Jersey Turnpike Authority DOVER TOWNSHIP 11/05/2010 10975.00000 39-59-17.4 N NJ MD KCO31 074-12-35.5 W 0004444439 New Jersey Turnpike Authority DOVER TOWNSHIP 11/05/2010 11015.00000 39-59-17.4 N NJ MD WPNB247 074-05-49.5 W 0004444440 New Jersey Turnpike Authority JERSEY CITY 11/05/2010 10735.00000 40-41-04.2 N NJ MD WPNB247 074-05-49.5 W 0004444440 New Jersey Turnpike Authority JERSEY CITY 11/05/2010 10775.00000 40-41-04.2 N NJ MD WPNB247 074-05-49.5 W 0004444440 New Jersey Turnpike Authority JERSEY CITY 11/05/2010 10895.00000 40-41-04.2 N NJ MD WPNB247 074-05-49.5 W 0004444440 New Jersey Turnpike Authority JERSEY CITY 11/05/2010 10935.00000 40-41-04.2 N NJ MD WPNB247 074-05-49.5 W 0004444440 New Jersey Turnpike Authority JERSEY
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302816A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302816A1.txt
  • WIRELESS PCS, LLCBrownsville 11/09/2010 35-38-59.2 N TN MD KNKQ293 089-13-59.2 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCBROWNSVILLE 11/09/2010 35-34-06.3 N TN MD KNKQ293 089-41-15.3 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCCollierville 11/09/2010 35-02-35.3 N TN MD KNKQ293 089-37-43.2 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCCOLLIERVILLE 11/09/2010 35-05-58.6 N TN MD KNKQ293 089-38-06.6 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCCOLLIERVILLE 11/09/2010 35-09-04.2 N TN MD KNKQ293 088-07-05.0 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCDECATURVILLE 11/09/2010 35-35-41.0 N TN MD KNKQ293 089-11-51.9 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCGrand Junction 11/09/2010 35-02-49.6 N TN MD KNKQ293 088-50-53.2 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCJackson 11/09/2010 35-43-41.3 N TN MD KNKQ293 089-00-54.4 W 0004447239 NEW CINGULAR WIRELESS PCS, LLCJACKSON 11/09/2010 35-36-35.4 N TN MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303068A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303068A1.txt
  • Ultra Broadband LLC MOUNT PLEASANT 11/24/2010 10755.00000 32-49-01.6 N SC MD WQMZ476 079-50-13.3 W 0004509010 Conterra Ultra Broadband LLC MOUNT PLEASANT 11/24/2010 10795.00000 32-49-01.6 N SC MD WQMZ476 079-50-13.3 W 0004509010 Conterra Ultra Broadband LLC MOUNT PLEASANT 11/24/2010 10835.00000 32-49-01.6 N SC MD WQMZ476 079-50-13.3 W 0004509010 Conterra Ultra Broadband LLC MOUNT PLEASANT 11/24/2010 10915.00000 32-49-01.6 N SC MD WQHP942 082-16-04.2 W 0004509181 Conterra Ultra Broadband, LLC Taylors 11/24/2010 05945.20000 34-56-49.4 N SC MD WQHP942 082-16-04.2 W 0004509181 Conterra Ultra Broadband, LLC Taylors 11/24/2010 06063.80000 34-56-49.4 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC MD WQHP942 082-16-04.2 W 0004509181
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303372A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303372A1.txt
  • TTY (202) 414-1255. Page 1 Location Termination Pending Call Sign Termination Licensee Name Location Date # City Latitude State Longitude Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. GE - PubSafty/SpecEmer/PubSaftyNtlPlan,806-817/851-862MHz,Conv Public Safety and Homeland Security Bureau 11/04/2010 WNMG465 FB2 LOUISIANA,STATE OF 859.51250000 BOHEMIA 29-32-12.8 N LA 89-44-4.2 W 1 1 11/04/2010 WNMG465 FX1 LOUISIANA,STATE OF 814.51250000 NEW ORLEAN 30-0-2.7 N LA 90-7-2.3 W 2 1 11/04/2010 WPMP612 FB2 LOUISIANA,STATE OF 856.16250000 ALEXANDRIA 31-18-56.7 N LA 92-28-12.5 W 4 1 11/04/2010 WPMP612 MO LOUISIANA,STATE OF 811.16250000 -- LA -- 8 1 11/04/2010 WPMQ475 FB2 LOUISIANA,STATE OF 859.06250000 ABBEVILLE 30-2-35.7 N LA 92-5-47.4 W 1 1 11/04/2010 WPMQ475 MO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303390A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303390A1.txt
  • N MS AM KNKQ298 088-42-44.2 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCDekalb 12/02/2010 32-46-02.7 N MS AM KNKQ298 088-31-38.4 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCLauderdale 12/02/2010 32-29-46.2 N MS AM KNKQ298 088-49-41.1 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCLAUDERDALE 12/02/2010 32-14-46.7 N MS AM KNKQ298 089-15-01.2 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCLAWRENCE 12/02/2010 32-23-16.9 N MS AM KNKQ298 088-41-04.2 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCMEERIDIAN 12/02/2010 32-19-35.5 N MS AM KNKQ298 088-34-14.1 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCMeridian 12/02/2010 32-24-39.5 N MS AM KNKQ298 088-33-15.3 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCMERIDIAN 12/02/2010 32-19-27.3 N MS AM KNKQ298 089-05-43.0 W 0004353432 NEW CINGULAR WIRELESS PCS, LLCNewton 12/02/2010 32-20-34.2 N MS AM KNKQ298 089-13-42.0 W 0004353432 NEW CINGULAR
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303392A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303392A1.txt
  • PCS, LLCPONCA CITY 12/02/2010 36-39-53.1 N OK AM KNKA356 095-04-59.8 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSALINA 12/02/2010 36-20-09.0 N OK AM KNKA356 096-11-56.6 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSapulpa 12/02/2010 35-58-41.0 N OK AM KNKA356 096-10-27.0 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSAPULPA 12/02/2010 35-58-35.3 N OK AM KNKA356 096-02-46.2 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSKIATOOK 12/02/2010 36-23-04.2 N OK AM KNKA356 096-07-30.4 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSKIATOOK 12/02/2010 36-24-13.7 N OK AM KNKA356 096-37-02.4 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSTROUD 12/02/2010 35-46-12.1 N OK AM KNKA356 096-37-05.1 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCSTROUD 12/02/2010 35-46-13.2 N OK AM KNKA356 095-50-20.0 W 0004359582 NEW CINGULAR WIRELESS PCS, LLCTulsa 12/02/2010 36-22-46.3 N OK AM KNKA356
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303395A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303395A1.txt
  • Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC MD WQGH366 079-20-51.1 W 0004512939 North Carolina State Highway Patrol Raeford 11/30/2010 06845.00000 35-03-27.5 N MI MD WQFJ583 085-12-16.9 W 0004514093 City of Battle Creek Battle Creek 11/30/2010 00956.10000 42-13-49.1 N MI MD WQFJ578 085-12-50.0 W 0004514095 City of Battle Creek ATHENS 11/30/2010 00959.70000 42-06-04.2 N MD MD WQJK787 077-08-57.0 W 0004514177 Montgomery, County of Rockville 11/30/2010 06695.00000 39-04-59.4 N MD MD WQJK787 077-08-57.0 W 0004514177 Montgomery, County of Rockville 11/30/2010 10895.00000 39-04-59.4 N MD MD WQJK787 077-08-57.0 W 0004514177 Montgomery, County of Rockville 11/30/2010 10935.00000 39-04-59.4 N CA MD WLA43 118-14-56.2 W 0004519032 LOS ANGELES, CITY OF LOS ANGELES 12/02/2010 11035.00000 34-07-10.0 N CA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303405A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303405A1.txt
  • 6,352 5,050 11,403 10,136 22,725 11,190 14,203 22,797 15,735 196 96,983 108,386 Percentages aDSL 3.7 5.2 8.9 7.0 20.6 28.3 30.0 4.0 1.2 0.0 91.1 100.0 sDSL 0.0 0.0 0.0 48.8 32.3 7.1 10.6 * * * 100.0 100.0 Other Wireline 0.0 0.0 0.0 6.7 2.5 54.5 13.0 22.1 1.0 0.1 100.0 100.0 Cable Modem 0.7 1.9 2.5 0.8 3.8 4.2 11.2 47.5 29.6 0.3 97.5 100.0 FTTP 0.1 0.0 0.1 0.4 1.0 2.0 10.3 1.5 83.2 1.5 99.9 100.0 Satellite 46.4 41.5 87.9 * * * * 0.0 0.0 0.0 12.1 100.0 Fixed Wireless 7.4 3.8 11.2 18.0 25.8 27.6 14.1 1.7 1.4 0.1 88.8 100.0 Mobile Wireless 13.6 7.3 20.9 22.5 44.5 4.0 2.5 * 0.0 * 79.1 100.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303633A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303633A1.txt
  • PR MD WQGV915 066-04-00.4 W 0004523112 NEPTUNO MEDIA San Juan 12/06/2010 21985.00000 18-26-42.4 N PR MD WQGV915 066-04-00.4 W 0004523112 NEPTUNO MEDIA San Juan 12/06/2010 22085.00000 18-26-42.4 N PR MD WQEV761 066-06-12.5 W 0004523113 NEPTUNO MEDIA Guaynabo 12/06/2010 22035.00000 18-24-51.6 N IN MD WQMP792 087-13-29.1 W 0004523298 INDIANA RSA NO. 5 LIMITED PARTNERBLOOMINGDALE 12/06/2010 06605.00000 39-52-41.6 N CA MD WLA630 117-46-04.2 W 0004523353 AT&T CALIFORNIA PALMDALE 12/06/2010 11245.00000 34-28-11.5 N CA MD WMV939 117-57-30.4 W 0004523354 AT&T CALIFORNIA LITTLE ROCK 12/06/2010 10755.00000 34-31-14.9 N CA MD WMQ735 118-10-37.1 W 0004523678 AT&T CALIFORNIA LA CANADA 12/06/2010 19115.00000 34-11-59.5 N CA MD WMQ735 118-10-37.1 W 0004523678 AT&T CALIFORNIA LA CANADA 12/06/2010 19470.00000 34-11-59.5 N CA MD WMQ734 118-06-18.5 W 0004523679 AT&T CALIFORNIA MT
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303634A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303634A1.txt
  • W 0004525973 FiberTower Network Services Corp. Bel Air 12/08/2010 11245.00000 39-36-38.9 N VA MD WQGH715 077-25-52.8 W 0004525974 FiberTower Network Services Corp. Chantilly 12/08/2010 10755.00000 38-53-29.8 N VA MD WQGH715 077-25-52.8 W 0004525974 FiberTower Network Services Corp. Chantilly 12/08/2010 10835.00000 38-53-29.8 N VA MD WQGH715 077-25-52.8 W 0004525974 FiberTower Network Services Corp. Chantilly 12/08/2010 10875.00000 38-53-29.8 N VA MD WQGP366 077-23-04.2 W 0004525975 FiberTower Network Services Corp. Prince William 12/08/2010 10755.00000 38-42-37.4 N VA MD WQGP366 077-23-04.2 W 0004525975 FiberTower Network Services Corp. Prince William 12/08/2010 10795.00000 38-42-37.4 N VA MD WQGP366 077-23-04.2 W 0004525975 FiberTower Network Services Corp. Prince William 12/08/2010 10915.00000 38-42-37.4 N MD MD WQHD785 076-19-12.9 W 0004525976 FiberTower Network Services Corp. Bel Air 12/08/2010 11245.00000 39-34-12.8 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303726A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303726A1.txt
  • W 0004533802 T-MOBILE LICENSE LLC Nashville 12/15/2010 18040.00000 36-04-04.5 N NC NE 078-58-01.9 W 0004533810 T-MOBILE LICENSE LLC Fayetteville 12/15/2010 22475.00000 35-02-16.9 N NC NE 078-59-18.9 W 0004533998 T-MOBILE LICENSE LLC Fayetteville 12/15/2010 18080.00000 35-02-22.0 N NC NE 078-59-18.9 W 0004533998 T-MOBILE LICENSE LLC Fayetteville 12/15/2010 21275.00000 35-02-22.0 N SC NE 081-00-49.4 W 0004534067 T-MOBILE LICENSE LLC Columbia 12/15/2010 19520.00000 33-58-04.2 N TN NE 086-39-32.8 W 0004534070 T-MOBILE LICENSE LLC Nashville 12/15/2010 22425.00000 36-05-58.7 N TN NE 086-37-56.6 W 0004534084 T-MOBILE LICENSE LLC Nashville 12/15/2010 19440.00000 36-08-04.3 N SC NE 080-58-28.4 W 0004534087 T-MOBILE LICENSE LLC COLUMBIA 12/15/2010 19640.00000 33-59-19.2 N NC NE 081-09-05.0 W 0004534156 T-MOBILE LICENSE LLC GASTONIA 12/15/2010 18040.00000 35-14-05.0 N SC NE 082-05-04.1 W 0004534169 T-MOBILE LICENSE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303727A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303727A1.txt
  • Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT MD KNKA259 111-46-16.8 W 0004532333 Verizon Wireless (VAW) LLC Huntsville 12/14/2010 41-16-16.0 N Page 14 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT MD KNKA259 112-04-50.8 W 0004532333 Verizon Wireless (VAW) LLC Plain City 12/14/2010 41-18-04.2 N CA MD KNKA751 121-33-48.8 W 0004532486 REDDING MSA LIMITED PARTNERSHIPShingletown 12/14/2010 40-33-31.5 N AR MD KNKN928 094-05-38.5 W 0004532708 NORTHWEST ARKANSAS RSA LIMITEDWaldron 12/14/2010 34-55-17.9 N OH MD KNKN840 082-11-23.5 W 0004535006 New Par Gann 12/15/2010 40-27-38.1 N OH MD KNKN840 082-13-04.0 W 0004535006 New Par Sullivan 12/15/2010 41-01-36.1 N IK - Industrial/Business Pool - Commercial, Conventional State Purpose
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303870A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303870A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303870A1.txt
  • Abbate, Inventing the Internet, p. 141 (MIT Press 2000). Lee Wei Lian, IP Scarcity Could Hit Unwary Businesses, Says Internet Body, The Malaysian Insider (Mar. 16, 2010). See Iljitsch van Beijnum, There is no Plan B: why the IPv4-to-IPv6 transition will be ugly, ars technical (Sept. 29, 2010). Geoff Huston, IPv4 Address Report. See ARIN Number Resource Policy Manual, Sec. 4.2 Allocation to ISPs (Jan. 13, 2010). Lljitsch van Beinjnum, Everything You Need to Know About IPv6, Ars Technica (Mar. 7, 2007) ("For instance, IBM, Xerox, HP, DEC, Apple and MIT all received "class A" address blocks of nearly 17 million addresses. (So HP, which acquired DEC, has more than 33 million addresses.)"); Geoff Huston, IPv4 Address Report ("Unneeded addresses are
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A1.txt
  • Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ..................................... Table 3.8 Safety Valve Support Payments by Study Area .......................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type . Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ............................................ Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Table 4.7 Schools & Libraries Disbursements per Student
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A11.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A11.txt
  • 4.9 4.3 5.9 4.8 4.6 2.9 7.6 4.8 4.3 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 98.6 97.4 99.6 99.0 98.5 99.8 99.1 98.8 98.4 Residence 98.6 98.4 99.6 98.9 98.4 99.8 99.2 98.9 98.8 Business 98.4 91.2 99.4 99.1 98.9 99.4 98.3 98.1 94.8 Average Installation Interval (days) 1.8 1.2 1.2 1.0 1.5 0.0 4.2 1.5 0.8 Residence 1.9 1.2 1.1 0.9 1.0 0.0 4.6 1.4 0.6 Business 1.7 1.2 1.8 1.4 3.3 0.2 1.6 1.7 3.4 Average Out of Service Repair Interval (hours) 26.1 33.1 35.5 32.4 19.3 17.5 30.1 49.8 28.2 Residence 27.5 36.7 36.5 33.9 19.5 18.0 32.5 57.3 30.8 Business 20.4 17.3 29.3 26.4 18.3 15.3 22.8 18.3 14.0 Initial Trouble
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A2.txt
  • Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ..................................... Table 3.8 Safety Valve Support Payments by Study Area .......................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type . Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ............................................ Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Table 4.7 Schools & Libraries Disbursements per Student
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A3.txt
  • 89,712 12,682 Competitive Access Providers 4,503 4,395 2.5 4,794 14,437 19,231 4,419 (CAPs) and Competitive Local Exchange Carriers (CLECs) Local Resellers 118 108 8.4 102 497 599 106 Private Service Providers 424 415 2.2 599 577 1,176 399 Shared-Tenant Service Providers 4 3 8.9 17 30 47 7 Coaxial Cable IVoIP Providers 5 Interconnected VoIP (IVoIP) Providers 5 1,272 1,219 4.2 263 2,808 3,071 1,204 Total IVoIP 5 Other Local Service Providers 107 106 2.8 127 263 391 104 Total Local Competitors 6,428 6,246 2.9 6,079 19,683 25,762 6,525 Fixed Local Service Providers 19,093 18,763 1.7 38,135 77,339 115,474 19,208 Payphone Service Providers 30 29 3.7 103 238 340 24 Wireless Telephony Including Cellular, 32,725 32,063 2.0 7,193 119,571 126,764 31,477
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A6.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A6.txt
  • type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the funding year. Also, disbursements may continue beyond the end of the funding year in the event of delayed internal connections installation. Thus, disbursements for the two most recent funding years will rise substantially. Table 4.2 summarizes commitments and disbursements by state and by type of applicant for funding years 2007 through 2009. Table 4.3 is based on the same data as Table 4.2 and shows, on a state-by-state basis, funding commitments and disbursements for the three major types of services: internal connections, Internet access, and telecommunications. The lists of individual funding commitments and disbursements are
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A8.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A8.txt
  • 1984 2009 Change Alabama 88.4% 95.2% 6.7% * Alaska 86.5 96.2 9.7 * Arizona 86.9 93.7 6.8 * Arkansas 86.6 93.0 6.5 * California 92.5 96.7 4.3 * Colorado 93.2 97.4 4.1 * Connecticut 95.5 97.7 2.2 Delaware 94.3 95.9 1.6 District of Columbia 94.9 92.2 -2.7 Florida 88.7 93.0 4.3 * Georgia 86.2 94.1 7.9 * Hawaii 93.5 97.7 4.2 * Idaho 90.7 97.0 6.2 * Illinois 94.2 95.1 0.9 Indiana 91.6 93.1 1.5 Iowa 96.2 98.1 1.9 Kansas 94.3 96.8 2.5 Kentucky 88.1 93.7 5.5 * Louisiana 89.7 95.9 6.2 * Maine 93.4 97.6 4.2 * Maryland 95.7 95.4 -0.3 Massachusetts 95.9 98.2 2.3 Michigan 92.8 96.7 3.8 * Minnesota 95.8 97.8 2.0 Mississippi 82.4 94.0 11.6 * Missouri
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A9.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A9.txt
  • 4.9 3.1 CPI Telephone Services 1 1.7 0.3 CPI Major Categories: - Food & Beverages * 2.8 - Housing * 2.7 - Apparel 1.9 -0.9 - Transportation 4.6 2.9 - Medical Care 5.9 4.1 - Recreation * 1.0 - Other Goods & Services * 3.7 CPI Public Transportation 5.0 2.0 CPI Utility (Piped) Gas Service 4.9 5.0 CPI Electricity 3.7 4.2 CPI Water & Sewerage Maintenance 5.7 5.1 CPI Postage 4.7 3.2 Source: Bureau of Labor Statistics. Table 7.1 (Annual Rates of Change) * Series not established until after 1955. 1 The CPI telephone service index was revised in December of 1997. Long-Term Changes for Various Price Indices Chart 7.1 CPI All Items and CPI Telephone Services Base Periods: 1982-84 =
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303907A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303907A1.txt
  • RM WLT541 076-59-16.5 W 0004548853 NEW CINGULAR WIRELESS PCS, LLCDillsburg 12/28/2010 06375.14000 40-05-33.3 N TX RM WPJE823 097-08-24.9 W 0004549191 New Cingular Wireless PCS, LLC WACO 12/28/2010 06063.80000 31-39-53.7 N TX RM WPJE823 097-08-24.9 W 0004549191 New Cingular Wireless PCS, LLC WACO 12/28/2010 06740.00000 31-39-53.7 N TX RM WMN489 097-07-52.8 W 0004549227 New Cingular Wireless PCS, LLC WACO 12/28/2010 06315.84000 31-33-04.2 N TX RM WMN489 097-07-52.8 W 0004549227 New Cingular Wireless PCS, LLC WACO 12/28/2010 10755.00000 31-33-04.2 N PA RM WLV536 076-52-02.9 W 0004549344 NEW CINGULAR WIRELESS PCS, LLCNEW CUMBERLAN 12/28/2010 06315.84000 40-11-30.3 N PA RM WLV536 076-52-02.9 W 0004549344 NEW CINGULAR WIRELESS PCS, LLCNEW CUMBERLAN 12/28/2010 10975.00000 40-11-30.3 N TX RM WLL252 097-13-48.1 W 0004549359 New Cingular Wireless PCS, LLC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304028A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304028A1.txt
  • N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 06855.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11215.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11285.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11365.00000 55-32-29.6 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06063.80000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06152.75000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06197.24000 34-13-56.0 N CA MD WPSQ228 117-29-42.2 W 0004558982 NEW CINGULAR WIRELESS PCS, LLCCamp Pendleton 01/04/2011 05945.20000 33-21-50.9 N CA MD WPSQ228
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304030A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304030A1.txt
  • HOLDINGS IIIWhittier 01/05/2011 18115.00000 33-56-55.0 N CA MD WQLN845 118-00-17.7 W 0004560879 CLEARWIRE SPECTRUM HOLDINGS IIIWhittier 01/05/2011 23075.00000 33-56-55.0 N CA MD WQLN845 118-00-17.7 W 0004560879 CLEARWIRE SPECTRUM HOLDINGS IIIWhittier 01/05/2011 23225.00000 33-56-55.0 N CA MD WQLN845 118-00-17.7 W 0004560879 CLEARWIRE SPECTRUM HOLDINGS IIIWhittier 01/05/2011 23375.00000 33-56-55.0 N CA MD WQLN619 118-13-32.2 W 0004560882 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/05/2011 19375.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004560882 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/05/2011 19475.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004560882 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/05/2011 21825.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004560882 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/05/2011 21875.00000 33-56-04.2 N CA MD WQLN619 118-13-32.2 W 0004560882 CLEARWIRE SPECTRUM HOLDINGS IIILynwood 01/05/2011 21925.00000 33-56-04.2 N CA MD WQLN619
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304032A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304032A1.txt
  • MD WQML827 122-01-53.3 W 0004564249 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/07/2011 23425.00000 37-18-30.9 N CA MD WQML827 122-01-53.3 W 0004564249 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/07/2011 23475.00000 37-18-30.9 N VT MD WNTK893 072-27-13.3 W 0004564501 CENTRAL VERMONT PUBLIC SERVICEWINDSOR 01/07/2011 06152.75000 43-26-36.3 N VT MD WNTK893 072-27-13.3 W 0004564501 CENTRAL VERMONT PUBLIC SERVICEWINDSOR 01/07/2011 06226.89000 43-26-36.3 N PA MD WQMP804 075-38-04.2 W 0004564550 Open Range Communications Scranton 01/07/2011 10915.00000 41-26-50.6 N Page 40 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WQMP804 075-38-04.2 W 0004564550 Open Range Communications Scranton 01/07/2011 17770.00000 41-26-50.6 N PA MD WQMQ257 075-27-39.2 W 0004564551 Open Range Communications CARBONDALE 01/07/2011 06063.80000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304054A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304054A1.txt
  • Local Telephone Competition: Status as of December 31, 2009 29 Zero 17.4%18.4%17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 Ten or More 36.9 35.0 35.3 34.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304135A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304135A1.txt
  • 01/10/2011 11245.00000 36-28-05.3 N ID MD WMR345 116-54-31.0 W 0004566831 Allied Wireless Communications CorporatPAYETTE 01/10/2011 06725.00000 44-03-45.0 N ID MD WMR345 116-54-31.0 W 0004566831 Allied Wireless Communications CorporatPAYETTE 01/10/2011 06765.00000 44-03-45.0 N ID MD WMR345 116-54-31.0 W 0004566831 Allied Wireless Communications CorporatPAYETTE 01/10/2011 06805.00000 44-03-45.0 N PA MD WLL936 080-09-38.2 W 0004571370 New Cingular Wireless PCS, LLC MERCER 01/13/2011 02128.00000 41-13-04.2 N PA MD WLL936 080-09-38.2 W 0004571370 New Cingular Wireless PCS, LLC MERCER 01/13/2011 05974.85000 41-13-04.2 N PA MD WLL936 080-09-38.2 W 0004571370 New Cingular Wireless PCS, LLC MERCER 01/13/2011 06123.10000 41-13-04.2 N PA MD WLL936 080-09-38.2 W 0004571370 New Cingular Wireless PCS, LLC MERCER 01/13/2011 06615.00000 41-13-04.2 N CO NE 107-52-48.0 W 0004565477 LP Broadband, Inc. Montrose 01/10/2011 17765.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304249A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304249A1.txt
  • WPOR287 097-19-27.7 W 0004582055 U S D 259 WICHITA 01/21/2011 23475.00000 37-39-29.5 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 00953.05000 42-28-58.1 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 06585.00000 42-28-58.1 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 06635.00000 42-28-58.1 N NY NE 073-50-04.2 W 0004578723 CLEARWIRE SPECTRUM HOLDINGS IIINew York 01/19/2011 21825.00000 40-41-11.0 N NY NE 073-50-04.2 W 0004578723 CLEARWIRE SPECTRUM HOLDINGS IIINew York 01/19/2011 22025.00000 40-41-11.0 N PA NE 076-50-05.3 W 0004578733 Open Range Communications Dover 01/19/2011 23080.00000 39-58-56.3 N PA NE 076-47-55.3 W 0004578734 Open Range Communications Shiloh 01/19/2011 11305.00000 39-58-05.2 N PA NE 076-47-55.3 W 0004578734 Open Range Communications Shiloh
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304388A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304388A1.txt
  • WI NE 091-49-01.7 W 0004584874 Illinois Central Railroad Company Solon Springs 01/24/2011 06034.15000 46-22-20.9 N WI NE 091-49-01.7 W 0004584874 Illinois Central Railroad Company Solon Springs 01/24/2011 06063.80000 46-22-20.9 N WI NE 090-33-50.8 W 0004584876 Illinois Central Railroad Company Owen 01/24/2011 06063.80000 44-57-06.2 N WI NE 090-33-50.8 W 0004584876 Illinois Central Railroad Company Owen 01/24/2011 06093.45000 44-57-06.2 N WI NE 088-31-04.2 W 0004584877 Illinois Central Railroad Company Oshkosh 01/24/2011 06197.24000 44-05-23.4 N WI NE 088-31-04.2 W 0004584877 Illinois Central Railroad Company Oshkosh 01/24/2011 06286.19000 44-05-23.4 N WI NE 090-24-13.8 W 0004584878 Illinois Central Railroad Company Riplinger 01/24/2011 06286.19000 44-49-28.2 N WI NE 090-24-13.8 W 0004584878 Illinois Central Railroad Company Riplinger 01/24/2011 06315.84000 44-49-28.2 N WI NE 091-21-09.1 W 0004584879 Illinois Central
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304516A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304516A1.txt
  • Murphysboro 02/01/2011 00928.73125 37-42-07.0 N IL NE 089-16-04.1 W 0004598127 Southern Illinois Power Cooperative Murphysboro 02/01/2011 00952.73125 37-42-07.0 N FL NE 081-29-59.9 W 0004598273 CLEARWIRE SPECTRUM HOLDINGS IIIApopka 02/01/2011 11505.00000 28-38-40.3 N TX NE 094-54-03.3 W 0004598283 Centerpoint Energy Inc. BAYTOWN 02/01/2011 06197.24000 29-46-28.1 N TX NE 094-54-03.3 W 0004598283 Centerpoint Energy Inc. BAYTOWN 02/01/2011 11325.00000 29-46-28.1 N TX NE 097-38-04.2 W 0004598290 RFIP, Inc. Cresson 02/01/2011 11215.00000 32-32-14.9 N TX NE 097-27-31.3 W 0004598412 Millenium Telcom, LLC dba OneSource CEagle Mountain 02/01/2011 11345.00000 32-55-17.8 N TX NE 097-34-25.6 W 0004598416 Millenium Telcom, LLC dba OneSource CAZLE 02/01/2011 10855.00000 32-53-03.5 N AK NE 148-03-21.9 W 0004598519 AlasConnect, Inc. Ester 02/01/2011 11685.00000 64-52-44.5 N Page 49 MG - Microwave Industrial/Business Pool State
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304517A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304517A1.txt
  • City TX MD WQKF468 097-03-51.0 W 0004603023 AirCanopy Internet Services BRITTON 02/04/2011 21825.00000 32-35-06.0 N TX MD WQKF470 096-56-18.2 W 0004603030 AirCanopy Internet Services CEDAR HILL 02/04/2011 23075.00000 32-34-40.1 N TX MD WQKD295 096-53-31.0 W 0004603043 AirCanopy Internet Services OVILLA 02/04/2011 21875.00000 32-31-41.7 N CA NE 122-10-29.8 W 0004600412 STANFORD HOSPITAL AND CLINICS STANFORD 02/02/2011 00956.26250 37-26-02.7 N TX NE 097-38-04.2 W 0004600611 Devon Gas Services, L.P. Cresson 02/03/2011 11215.00000 32-32-14.9 N OH NE 081-29-46.3 W 0004600883 Open Range Communications DOVER 02/03/2011 11215.00000 40-30-31.0 N OH NE 081-29-46.3 W 0004600883 Open Range Communications DOVER 02/03/2011 17750.00000 40-30-31.0 N OH NE 081-29-46.3 W 0004600883 Open Range Communications DOVER 02/03/2011 17810.00000 40-30-31.0 N FL NE 081-31-50.3 W 0004601057 JEA Jacksonville 02/03/2011 00928.29375 30-08-49.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304772A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304772A1.txt
  • JUNIATA COUNTY EMERGENCY SERVIBEAVER TWP 02/17/2011 06093.45000 40-43-34.5 N PA NE 078-32-37.5 W 0004619494 BEDFORD, COUNTY OF RAINSBURG 02/17/2011 06226.89000 39-49-48.9 N PA NE 078-17-25.9 W 0004619507 BEDFORD, COUNTY OF SAXTON 02/17/2011 11385.00000 40-14-11.9 N MA NE 071-53-31.2 W 0004619796 Massachusetts Water Resources AuthorityPrinceton 02/17/2011 06811.25000 42-29-20.3 N SC NE 079-46-03.0 W 0004619834 City of Florence, SC Florence 02/17/2011 19540.00000 34-08-04.2 N SC NE 079-46-07.2 W 0004619837 City of Florence, SC Florence 02/17/2011 17980.00000 34-11-55.5 N RI NE 071-27-48.3 W 0004619946 City of Providence RI Public Safety CommCranston 02/17/2011 11648.12500 41-44-41.3 N GA NE 084-02-09.2 W 0004619964 County of Forsyth CUMMING 02/17/2011 06256.54000 34-18-06.5 N GA NE 084-02-09.2 W 0004619964 County of Forsyth CUMMING 02/17/2011 06345.49000 34-18-06.5 N GA NE 084-05-37.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304774A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304774A1.txt
  • 00494.00000 41-52-59.4 N IL NE P 087-37-43.7 W 0004621930 CBS BROADCASTING INC. Chicago 02/18/2011 00494.00000 - 00608.00000 41-52-59.4 N IL NE P 087-37-43.7 W 0004621930 CBS BROADCASTING INC. Chicago 02/18/2011 00614.00000 - 00698.00000 41-52-59.4 N MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA AM WQMP804 075-38-04.2 W 0004564550 Open Range Communications Scranton 02/18/2011 10915.00000 41-26-50.6 N PA AM WQMP804 075-38-04.2 W 0004564550 Open Range Communications Scranton 02/18/2011 11215.00000 41-26-50.6 N PA AM WQMP804 075-38-04.2 W 0004564550 Open Range Communications Scranton 02/18/2011 17770.00000 41-26-50.6 N PA AM WQMQ257 075-27-39.2 W 0004564551 Open Range Communications CARBONDALE 02/18/2011 06063.80000 41-32-41.3 N PA AM WQMQ257 075-27-39.2 W 0004564551 Open Range
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304911A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304911A1.txt
  • Services Corp. WHITE MARSH 02/24/2011 11215.00000 39-23-43.0 N IN NE 087-23-58.8 W 0004629606 St. Francisville Properties, Inc. Terre Haute 02/24/2011 17865.00000 39-24-02.6 N NY NE 074-00-21.5 W 0004629727 Towerstream Corp. New York 02/24/2011 22075.00000 40-43-38.8 N NY NE 073-58-17.3 W 0004629728 Towerstream Corp. New York 02/24/2011 22075.00000 40-45-15.2 N NJ NE 074-06-04.7 W 0004629730 Towerstream Corp. New York 02/24/2011 11035.00000 40-49-04.2 N NY NE 073-59-30.8 W 0004629731 Towerstream Corp. New York 02/24/2011 21820.00000 40-44-19.6 N GA NE 084-17-54.0 W 0004629733 TOWER CLOUD, INC. Sandy Springs 02/24/2011 11425.00000 33-58-02.0 N GA NE 084-20-51.0 W 0004629734 TOWER CLOUD, INC. Sandy Springs 02/24/2011 10935.00000 33-58-09.0 N GA NE 084-19-47.3 W 0004629735 TOWER CLOUD, INC. Atlanta 02/24/2011 17965.00000 33-45-26.6 N GA NE 084-19-47.3 W 0004629735
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305045A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305045A1.txt
  • 0004636145 Enbridge Energy Company, Inc. Jermyn 03/01/2011 06315.84000 33-15-55.8 N TX NE 098-09-43.0 W 0004636149 Enbridge Energy Company, Inc. JACKSBORO 03/01/2011 06226.89000 33-08-13.5 N Page 43 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 05945.20000 35-36-04.2 N TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 05974.85000 35-36-04.2 N TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 06004.50000 35-36-04.2 N OK NE 099-50-35.0 W 0004636152 Enbridge Energy Company, Inc. SWEETWATER 03/01/2011 06197.24000 35-25-24.0 N TX NE 100-23-45.7 W 0004636153 Enbridge Energy Company, Inc. Wheeler 03/01/2011 06226.89000 35-27-53.0 N TX NE 100-23-33.2
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305046A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305046A1.txt
  • N PR MD WMK680 066-06-36.5 W 0004641299 AT&T Mobility Puerto Rico Inc. AGUAS BUENAS 03/04/2011 11525.00000 18-16-42.7 N ME NE 070-29-51.6 W 0004638764 Northeast Wireless Networks LLC South Paris 03/03/2011 18015.00000 44-14-32.8 N ME NE 070-29-51.6 W 0004638764 Northeast Wireless Networks LLC South Paris 03/03/2011 18115.00000 44-14-32.8 N ME NE 070-21-57.2 W 0004638765 Northeast Wireless Networks LLC Buckfield 03/03/2011 17815.00000 44-17-04.2 N ME NE 070-21-57.2 W 0004638765 Northeast Wireless Networks LLC Buckfield 03/03/2011 17915.00000 44-17-04.2 N ME NE 069-44-13.1 W 0004638766 Northeast Wireless Networks LLC Dresden 03/03/2011 17765.00000 44-06-49.3 N ME NE 069-44-13.1 W 0004638766 Northeast Wireless Networks LLC Dresden 03/03/2011 17865.00000 44-06-49.3 N ME NE 069-41-25.8 W 0004638767 Northeast Wireless Networks LLC WISCASSET 03/03/2011 10735.00000 44-04-16.1 N ME NE 069-41-25.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305197A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305197A1.txt
  • 122-04-12.1 W 0004646116 CLEARWIRE SPECTRUM HOLDINGS IIIPleasant Hill 03/09/2011 11485.00000 37-56-06.4 N CA MD WQND227 122-04-12.1 W 0004646116 CLEARWIRE SPECTRUM HOLDINGS IIIPleasant Hill 03/09/2011 11645.00000 37-56-06.4 N CA MD WQND227 122-04-12.1 W 0004646116 CLEARWIRE SPECTRUM HOLDINGS IIIPleasant Hill 03/09/2011 21925.00000 37-56-06.4 N CA MD WQND227 122-04-12.1 W 0004646116 CLEARWIRE SPECTRUM HOLDINGS IIIPleasant Hill 03/09/2011 22075.00000 37-56-06.4 N CA MD WQND435 122-09-04.2 W 0004646218 CLEARWIRE SPECTRUM HOLDINGS IIISan Leandro 03/09/2011 23025.00000 37-43-33.7 N CA MD WQND435 122-09-04.2 W 0004646218 CLEARWIRE SPECTRUM HOLDINGS IIISan Leandro 03/09/2011 23075.00000 37-43-33.7 N CA MD WQND435 122-09-04.2 W 0004646218 CLEARWIRE SPECTRUM HOLDINGS IIISan Leandro 03/09/2011 23175.00000 37-43-33.7 N CA MD WQND435 122-09-04.2 W 0004646218 CLEARWIRE SPECTRUM HOLDINGS IIISan Leandro 03/09/2011 23225.00000 37-43-33.7 N CA MD WQMD301 122-09-20.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305296A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305296A1.txt
  • 60% Greater than 60 and no more than 80% Greater than 80 and no more than 100% 100% or more aDSL 6.1 10.7 10.2 25.0 20.1 12.9 7.1 3.5 2.6 0.8 1.0 sDSL 94.5 5.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Other Wireline 99.1 0.7 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Cable Modem 6.3 4.2 4.6 13.9 17.2 16.5 14.1 9.9 8.9 2.6 1.8 FTTP 81.8 7.5 1.7 2.5 1.9 1.5 1.2 0.8 0.7 0.2 0.2 Satellite 46.0 49.2 3.6 1.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 86.2 10.9 1.5 1.0 0.3 0.1 0.0 0.0 0.0 0.0 0.0 Power Line 99.9 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 All
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305297A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305297A1.txt
  • Federal Communications Commission Local Telephone Competition: Status as of June 30, 2010 28 Zero 17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% 7.1% One 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 8.7 Two 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 7.4 Three 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 6.2 Four 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 5.2 Five 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 4.7 Six 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 4.2 Seven 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 3.6 Eight 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 3.4 Nine 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 2.8 Ten or More 35.3 34.0 33.5 33.1 33.6 44.7 44.0 44.0 46.6
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305322A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305322A1.txt
  • Cooperative Tribune 03/16/2011 11285.00000 38-28-31.2 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00928.23125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00928.48125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00952.23125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00952.48125 48-21-50.7 N IN NE 087-11-04.2 W 0004655424 COMMUNITY FOUNDATION OF NW INDPortage 03/17/2011 11245.00000 41-33-35.3 N NE NE 098-04-03.8 W 0004655531 Superior iNET Superior 03/17/2011 10775.00000 40-07-31.9 N NE NE 097-58-15.6 W 0004655533 Superior iNET Edgar 03/17/2011 11265.00000 40-21-45.5 N NE NE 097-58-15.6 W 0004655533 Superior iNET Edgar 03/17/2011 11385.00000 40-21-45.5 N NE NE 097-50-33.0 W 0004655534 Superior iNET Sutton 03/17/2011 10895.00000 40-36-42.6 N TX
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305323A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305323A1.txt
  • Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ME NE 070-29-51.6 W 0004657413 Northeast Wireless Networks LLC South Paris 03/18/2011 18015.00000 44-14-32.8 N ME NE 070-29-51.6 W 0004657413 Northeast Wireless Networks LLC South Paris 03/18/2011 18115.00000 44-14-32.8 N ME NE 070-21-57.2 W 0004657417 Northeast Wireless Networks LLC Buckfield 03/18/2011 17815.00000 44-17-04.2 N ME NE 070-21-57.2 W 0004657417 Northeast Wireless Networks LLC Buckfield 03/18/2011 17915.00000 44-17-04.2 N ME NE 069-44-13.1 W 0004657421 Northeast Wireless Networks LLC Dresden 03/18/2011 17765.00000 44-06-49.3 N ME NE 069-44-13.1 W 0004657421 Northeast Wireless Networks LLC Dresden 03/18/2011 17865.00000 44-06-49.3 N ME NE 069-41-25.8 W 0004657426 Northeast Wireless Networks LLC WISCASSET 03/18/2011 10735.00000 44-04-16.1 N ME NE 069-41-25.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305453A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305453A1.txt
  • Wireless, Inc. Castor 03/22/2011 06226.89000 32-16-17.6 N NV NE 115-10-53.3 W 0004662566 New Cingular Wireless PCS, LLC LAS VEGAS 03/23/2011 10875.00000 35-56-55.6 N NY NE 074-00-21.5 W 0004662733 Towerstream Corp. New York 03/23/2011 22075.00000 40-43-38.8 N NY NE 073-58-17.3 W 0004662737 Towerstream Corp. New York 03/23/2011 22075.00000 40-45-15.2 N NJ NE 074-06-04.7 W 0004662738 Towerstream Corp. New York 03/23/2011 11035.00000 40-49-04.2 N NY NE 073-59-30.8 W 0004662739 Towerstream Corp. New York 03/23/2011 21820.00000 40-44-19.6 N CA NE 122-23-36.8 W 0004662740 Towerstream Corp. San Francisco 03/23/2011 22335.00000 37-47-44.7 N CA NE 122-24-06.4 W 0004662741 Towerstream Corp. San Francisco 03/23/2011 22235.00000 37-47-16.0 N CA NE 122-18-10.7 W 0004662742 Towerstream Corp. San Francisco 03/23/2011 17920.00000 37-46-55.5 N CA NE 122-23-51.7 W 0004662743 Towerstream Corp.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305552A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305552A1.txt
  • 0004644106 Thought Transmissions LLC Tallmadge 03/28/2011 06093.45000 41-05-48.0 N OH AM 081-28-27.6 W 0004644106 Thought Transmissions LLC Tallmadge 03/28/2011 06152.75000 41-05-48.0 N OH AM 081-39-25.0 W 0004644146 Thought Transmissions LLC Akron 03/28/2011 06345.49000 41-07-57.0 N OH AM 081-39-25.0 W 0004644146 Thought Transmissions LLC Akron 03/28/2011 06404.79000 41-07-57.0 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 02139.60000 36-48-04.2 N Page 41 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 06750.00000 36-48-04.2 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 06835.00000 36-48-04.2 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305954A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305954A1.txt
  • MD KRH37 092-13-34.6 W 0004687449 BNSF Railway Co. BARING 04/12/2011 06635.00000 40-14-22.7 N MO MD KRH37 092-13-34.6 W 0004687449 BNSF Railway Co. BARING 04/12/2011 06695.00000 40-14-22.7 N MO MD KRH36 092-29-37.0 W 0004687451 BNSF Railway Co. LA PLATA 04/12/2011 06795.00000 40-01-42.9 N MO MD KRH36 092-29-37.0 W 0004687451 BNSF Railway Co. LA PLATA 04/12/2011 06855.00000 40-01-42.9 N MO MD KRH35 092-38-04.2 W 0004687464 BNSF Railway Co. ELMER 04/12/2011 06645.00000 39-51-08.2 N MO MD KRH35 092-38-04.2 W 0004687464 BNSF Railway Co. ELMER 04/12/2011 06695.00000 39-51-08.2 N MO MD WPUF488 092-57-15.1 W 0004687469 BNSF Railway Co. Marceline 04/12/2011 06775.00000 39-42-22.9 N MO MD WPUF488 092-57-15.1 W 0004687469 BNSF Railway Co. Marceline 04/12/2011 06805.00000 39-42-22.9 N MO MD KRH33 093-23-35.4 W 0004687474 BNSF Railway
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305957A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305957A1.txt
  • 21-54-43.0 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 080-40-21.5 W 0004690248 Verizon Wireless Personal CommunicationMerritt Island 04/14/2011 05974.85000 28-30-20.1 N FL NE 080-40-21.5 W 0004690248 Verizon Wireless Personal CommunicationMerritt Island 04/14/2011 06004.50000 28-30-20.1 N FL NE 080-46-04.2 W 0004690254 Verizon Wireless Personal CommunicationCocoa 04/14/2011 06226.89000 28-27-01.0 N FL NE 080-46-04.2 W 0004690254 Verizon Wireless Personal CommunicationCocoa 04/14/2011 06256.54000 28-27-01.0 N SC NE 081-42-26.9 W 0004690627 Verizon Wireless of the East LP AIKEN 04/14/2011 05945.20000 33-30-30.6 N GA NE 081-47-35.9 W 0004690628 Verizon Wireless of the East LP WAYNESBORO 04/14/2011 06226.89000 33-09-05.5 N SC NE 081-47-22.0 W 0004690629
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306104A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306104A1.txt
  • W 0004698866 COMMONWEALTH OF PENNSYLVANIAPLEASANTVILLE 04/21/2011 06785.00000 41-35-48.3 N PA MD WPTG684 079-35-47.6 W 0004698866 COMMONWEALTH OF PENNSYLVANIAPLEASANTVILLE 04/21/2011 06805.00000 41-35-48.3 N PA MD WPTG684 079-35-47.6 W 0004698866 COMMONWEALTH OF PENNSYLVANIAPLEASANTVILLE 04/21/2011 06815.00000 41-35-48.3 N PA MD WPTG684 079-35-47.6 W 0004698866 COMMONWEALTH OF PENNSYLVANIAPLEASANTVILLE 04/21/2011 06845.00000 41-35-48.3 N MN MD WPQL516 093-33-54.5 W 0004699452 HENNEPIN, COUNTY OF Rogers 04/21/2011 10715.00000 45-12-04.2 N MN MD WPQL516 093-33-54.5 W 0004699452 HENNEPIN, COUNTY OF Rogers 04/21/2011 10795.00000 45-12-04.2 N TX MD WQGC501 096-30-47.4 W 0004699948 Limestone County, Texas Groesbeck 04/21/2011 00957.95000 31-31-33.1 N TX MD WQGC499 096-30-35.3 W 0004699965 Limestone County, Texas GROESBECK 04/21/2011 00954.35000 31-31-12.9 N OH MD WNTZ344 080-39-21.0 W 0004700002 JEFFERSON, COUNTY OF Steubenville 04/21/2011 06590.62500 40-21-06.2 N OH MD WNTZ344
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306105A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306105A1.txt
  • W 0004699910 New Cingular Wireless PCS, LLC King City 04/21/2011 40-02-24.7 N MO MD KNKN553 094-51-37.8 W 0004699910 New Cingular Wireless PCS, LLC Maryville 04/21/2011 40-10-25.8 N MO MD KNKN553 094-53-06.4 W 0004699910 New Cingular Wireless PCS, LLC MARYVILLE 04/21/2011 40-22-00.1 N MO MD KNKN553 095-31-52.7 W 0004699910 New Cingular Wireless PCS, LLC Rockport 04/21/2011 40-24-27.1 N MO MD KNKN553 095-38-04.2 W 0004699910 New Cingular Wireless PCS, LLC Rockport 04/21/2011 40-34-13.4 N MO MD KNKN553 095-17-55.7 W 0004699910 New Cingular Wireless PCS, LLC TARKIO 04/21/2011 40-26-07.7 N KS MD KNKN553 095-02-21.0 W 0004699910 New Cingular Wireless PCS, LLC TROY 04/21/2011 39-47-34.0 N TX MD KNKA321 106-03-52.0 W 0004700448 Alltel Communications Southwest HoldingFabens 04/21/2011 31-33-47.9 N FL MD KNKN605 081-45-10.3 W 0004700573
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306296A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306296A1.txt
  • HOLDINGS IIIDenver 04/25/2011 19625.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22025.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22225.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22375.00000 39-41-34.4 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10815.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10895.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10935.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 11055.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 11135.00000 39-41-04.2 N Page 33 MG
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306297A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306297A1.txt
  • State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WOG99 121-20-29.8 W 0004627871 CBS RADIO HOLDINGS INC. Sacramento 04/29/2011 00951.50000 38-39-36.6 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK AM 149-53-04.2 W 0004637812 GCI Communication Corp Anchorage 04/29/2011 17910.00000 61-11-14.5 N TX AM 093-45-25.8 W 0004647026 GTE Mobilnet of South Texas Limited PartOrange 04/29/2011 06256.54000 30-10-45.2 N Page 1 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM 093-45-25.8 W 0004647026 GTE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306419A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306419A1.txt
  • POWER COMCLOVER 05/02/2011 06152.75000 36-52-06.5 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA AM WNTR649 078-42-28.0 W 0004665166 VIRGINIA ELECTRIC AND POWER COMCLOVER 05/02/2011 06780.00000 36-52-06.5 N IL AM 088-56-34.0 W 0004687739 UNION PACIFIC RAILROAD COMPANYDIX 05/05/2011 06755.00000 38-25-30.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 11265.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 11385.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23025.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23175.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23325.00000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306439A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306439A1.txt
  • City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 04/06/2011 WQKW558 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11095.00000000 Eddystone 39-51-32.6 N PA 75-20-45.3 W 1 1 04/06/2011 WQKW558 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11175.00000000 Eddystone 39-51-32.6 N PA 75-20-45.3 W 1 1 04/06/2011 WQKW559 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11095.00000000 WEST GOSHE 39-58-4.2 N PA 75-35-28.3 W 5 1 04/06/2011 WQKW559 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11175.00000000 WEST GOSHE 39-58-4.2 N PA 75-35-28.3 W 5 1 04/07/2011 WQKW585 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17865.00000000 Baltimore 39-5-43.5 N MD 76-48-1.6 W 1 1 04/07/2011 WQKW596 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17915.00000000 Bensalem 40-3-36.0 N PA 74-58-36.0 W 3 1 04/07/2011 WQKW596
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306653A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306653A1.txt
  • LLC SEWANEE 05/11/2011 11245.00000 35-14-55.9 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 06226.89000 36-01-04.7 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 11245.00000 36-01-04.7 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 11325.00000 36-01-04.7 N TN NE 086-43-35.9 W 0004724825 Conterra Ultra Broadband LLC GREENBRIER 05/11/2011 10795.00000 36-26-04.2 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11245.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11285.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11325.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11405.00000 36-28-21.7
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306819A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306819A1.txt
  • AM 086-21-10.8 W 0004726643 Duke Energy Carolinas, LLC Logansport 05/19/2011 00952.38125 40-45-44.1 N UT AM 111-25-21.1 W 0004732550 Digis LLC Heber 05/19/2011 11015.00000 40-29-41.9 N Page 21 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT AM 111-35-34.0 W 0004732551 Digis LLC Pleasant Grove 05/19/2011 11505.00000 40-22-04.2 N UT AM 111-35-34.0 W 0004732551 Digis LLC Pleasant Grove 05/19/2011 11585.00000 40-22-04.2 N UT AM WQJN416 111-51-27.0 W 0004732569 DIGIS LLC LOGAN 05/19/2011 18015.00000 41-44-40.0 N UT AM WQNP242 111-37-07.7 W 0004732575 Digis LLC Springville 05/19/2011 17765.00000 40-10-55.5 N UT AM 111-48-55.0 W 0004732579 Digis LLC Logan 05/19/2011 19575.00000 41-44-59.6 N UT AM WQJF816 112-01-11.1 W 0004732583 Digis LLC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308078A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308078A1.txt
  • State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD KNKN854 084-32-15.0 W 0004777625 New Cingular Wireless PCS, LLC Defiance 06/23/2011 41-17-29.0 N OH MD KNKN854 084-42-00.8 W 0004777625 New Cingular Wireless PCS, LLC EDGERTON 06/23/2011 41-28-05.2 N OH MD KNKN854 084-45-54.9 W 0004777625 New Cingular Wireless PCS, LLC Hicksville 06/23/2011 41-16-04.2 N OH MD KNKN854 084-45-45.0 W 0004777625 New Cingular Wireless PCS, LLC Hicksville 06/23/2011 41-17-53.3 N OH MD KNKN854 084-09-22.0 W 0004777625 New Cingular Wireless PCS, LLC HOLGATE 06/23/2011 41-18-00.0 N OH MD KNKN854 084-40-07.0 W 0004777625 New Cingular Wireless PCS, LLC MONTPELIAR 06/23/2011 41-37-19.0 N OH MD KNKN854 084-05-17.0 W 0004777625 New Cingular Wireless PCS, LLC NAPOLEON 06/23/2011 41-24-41.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308079A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308079A1.txt
  • NE 084-57-12.1 W 0004778335 Kentucky RSA 4 Cellular General PartnersLiberty 06/23/2011 11305.00000 37-17-03.1 N KY NE 085-02-39.7 W 0004778354 Kentucky RSA 4 Cellular General PartnersRussell Springs 06/23/2011 10815.00000 37-07-44.7 N OK NE 095-37-22.5 W 0004778366 Pine Telephone Company Inc Antlers 06/23/2011 11265.00000 34-13-38.4 N OK NE 095-37-22.5 W 0004778366 Pine Telephone Company Inc Antlers 06/23/2011 11305.00000 34-13-38.4 N KY NE 086-55-04.2 W 0004778577 Kentucky RSA #3 Cellular General PartneHartford 06/23/2011 11325.00000 37-31-30.4 N OK NE 095-33-26.8 W 0004778608 Pine Telephone Company Inc Grant 06/23/2011 11225.00000 33-57-20.2 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OK NE 095-33-26.8 W 0004778608 Pine
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308228A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308228A1.txt
  • KNKN570 093-15-15.2 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 06/29/2011 39-06-34.7 N MO MD KNKN570 093-11-14.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 06/29/2011 39-08-44.9 N Page 23 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD KNKN570 093-57-28.5 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCOdessa 06/29/2011 39-01-04.2 N MO MD KNKN570 093-16-34.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCSEDALIA 06/29/2011 38-44-46.1 N MO MD KNKN570 093-37-59.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWARRENSBURG 06/29/2011 38-43-24.5 N MO MD KNKN570 093-30-39.0 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWaverly 06/29/2011 39-12-18.2 N MO MD KNKN570 093-37-27.2 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWAVERLY 06/29/2011 39-11-34.7 N NJ MD KNKA652
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308243A3.doc
  • 3.2.2 Comments Received - August 2009 6 3.3 FCC Docket 09-109 8 3.4 Interim Report and Second Comment Round 9 Section 4.0 Analysis 11 4.1 The Adoption of the Change Orders Was Not Substantively Defective 11 4.1.1 Telcordia's Argument 11 4.1.2 IP Voice, SMS, and MMS Constitute ``Telephone Calls'' 11 4.1.3 The URIs Are ``Necessary to Route Telephone Calls'' 13 4.2 Telcordia's Procedural Arguments Are Moot 17 Section 5.0 Conclusion and Recommendation 18 Executive Summary The North American Numbering Council ("NANC") herein addresses a request for resolution of a dispute concerning the decision by the North American Portability Management LLC ("NAPM") to adopt and execute Amendment 72 to the extent that it includes Change Orders NANC 429, 430, and 435. Change
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308247A1.doc
  • Overall Assessment of the NANPA (Section G) There was one question in this section to which respondents provided the following aggregated response ratings: 32 as Exceeded 26 as More than Met 12 as Met See Appendix C for numerical survey results, Appendix D for the numerical bar charts, and Appendix E for the 2010 Cover Letter and NANPA Performance Survey. 4.2 Written Comments The Comment Sections in the survey allowed respondents the opportunity to provide details regarding their satisfaction or dissatisfaction with NANPA's performance in 2010. The NOWG reviewed all comments to determine if there was a common theme substantiated by multiple respondents. Following is a summary of written comments that were provided by survey respondents. Significant praise for NANPA staff
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308471A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308471A1.txt
  • Limited Partnership KENANSVILLE 07/11/2011 27-47-19.0 N FL MD KNKA253 080-59-51.1 W 0004797649 Orlando SMSA Limited Partnership KENANSVILLE 07/11/2011 27-55-18.9 N FL MD KNKA253 081-35-15.8 W 0004797649 Orlando SMSA Limited Partnership Kissimmee 07/11/2011 28-17-00.9 N FL MD KNKA253 080-51-51.5 W 0004797649 Orlando SMSA Limited Partnership KISSIMMEE 07/11/2011 28-05-19.7 N FL MD KNKA253 081-22-30.4 W 0004797649 Orlando SMSA Limited Partnership KISSIMMEE 07/11/2011 28-08-04.2 N FL MD KNKA253 081-27-23.0 W 0004797649 Orlando SMSA Limited Partnership KISSIMMEE 07/11/2011 28-10-59.8 N FL MD KNKA253 081-27-53.1 W 0004797649 Orlando SMSA Limited Partnership KISSIMMEE 07/11/2011 28-11-49.5 N FL MD KNKA253 081-37-04.6 W 0004797649 Orlando SMSA Limited Partnership LAKE BUENA VISTA 07/11/2011 28-23-07.1 N FL MD KNKA253 081-37-34.6 W 0004797649 Orlando SMSA Limited Partnership MOUNT DORA 07/11/2011 28-46-20.2 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308621A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308621A1.txt
  • LLC 19625.00000000 FT. WORTH 32-44-55.6 N TX 97-10-45.8 W 1 1 06/18/2011 WQLD951 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 FT. WORTH 32-44-55.6 N TX 97-10-45.8 W 3 1 06/18/2011 WQLD951 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19475.00000000 FT. WORTH 32-44-55.6 N TX 97-10-45.8 W 3 1 06/18/2011 WQLD953 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17815.00000000 Mansfield 32-36-16.1 N TX 97-7-4.2 W 1 1 06/18/2011 WQLD953 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17915.00000000 Mansfield 32-36-16.1 N TX 97-7-4.2 W 1 1 06/18/2011 WQLD962 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23325.00000000 Mesquite 32-48-21.8 N TX 96-40-0.6 W 2 1 06/18/2011 WQLD962 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23425.00000000 Mesquite 32-48-21.8 N TX 96-40-0.6 W 2 1 06/22/2011 WQLE241 FXO AirCanopy Internet Services
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308628A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308628A1.txt
  • Inc. DETROIT 07/18/2011 17915.00000 42-22-09.0 N MI NE 084-02-14.4 W 0004806530 Internet 123 Inc. Manchester 07/18/2011 10815.00000 42-09-06.8 N TX NE 097-07-37.3 W 0004806685 Internet America Waco, TX 07/18/2011 11095.00000 31-34-52.2 N TX NE 097-05-41.0 W 0004806686 Internet America West, TX 07/18/2011 11505.00000 31-47-48.9 N TX NE 097-05-41.0 W 0004806686 Internet America West, TX 07/18/2011 11585.00000 31-47-48.9 N TX NE 097-05-04.2 W 0004806687 Internet America Hillsboro, TX 07/18/2011 11015.00000 32-00-49.0 N MI NE 083-50-44.5 W 0004807313 Air Advantage, LLC Saginaw 07/19/2011 11345.00000 43-28-26.8 N MI NE 083-11-23.8 W 0004807317 Air Advantage, LLC North Branch 07/19/2011 10815.00000 43-13-56.5 N MI NE 083-04-37.0 W 0004807320 Air Advantage, LLC Marlette 07/19/2011 11305.00000 43-15-47.0 N MI NE 083-27-31.0 W 0004807323 Air Advantage, LLC Otter Lake
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308629A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308629A1.txt
  • Tamaqua 07/22/2011 10835.00000 40-49-40.5 N AZ NE 109-03-20.5 W 0004811725 Conterra Ultra Broadband LLC Red Valley 07/22/2011 19375.00000 36-34-30.1 N AZ NE 109-05-46.0 W 0004811730 Conterra Ultra Broadband LLC Sweetwater 07/22/2011 17815.00000 36-27-39.4 N NC NE 077-31-29.5 W 0004811768 Conterra Ultra Broadband LLC Farmville 07/22/2011 10755.00000 35-35-26.7 N NC NE 077-29-35.5 W 0004811769 Conterra Ultra Broadband LLC Farmville 07/22/2011 11245.00000 35-33-04.2 N CA NE 120-37-10.9 W 0004811913 NEW CINGULAR WIRELESS PCS, LLCSAN LUIS OBISPO 07/22/2011 10705.00000 35-11-56.1 N WY NE 106-19-53.8 W 0004812081 Verizon Wireless (VAW) LLC Casper 07/22/2011 05974.85000 42-56-22.7 N CA NE 120-47-02.8 W 0004812858 Verizon Wireless (VAW) LLC Morro Bay 07/22/2011 11605.00000 35-25-46.8 N AK NE 161-46-06.2 W 0004813621 GCI Communication Corp Oscarville 07/22/2011 11285.00000 60-43-19.2 N AK
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.txt
  • stream with the same characteristics and properties (i.e., packet sizes, delays, bitrate) as the G.711 codec. The test measured jitter, delay and loss. These metrics were measured by subdividing the stream into blocks, and measuring the time taken to receive each block (as well as the difference between consecutive times). Jitter was calculated using the PDV approach described in section 4.2 of RFC5481. The 99th percentile was recorded and used in all calculations when deriving the PDV. DNS RESOLUTION AND DNS FAILURES These tests measured the DNS resolution time of an A record query for the domains of the websites used in the web browsing test, and the percentage of DNS requests performed in the DNS resolution test that failed. The
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308838A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308838A1.txt
  • 0004815187 North Central ESD Condon 07/25/2011 21925.00000 45-14-10.0 N OR NE 120-10-55.5 W 0004815195 North Central ESD Condon 07/25/2011 23125.00000 45-14-08.5 N OR NE 120-10-57.6 W 0004815217 North Central ESD Condon 07/25/2011 23035.00000 45-13-54.5 N OR NE 119-46-43.9 W 0004818266 North Central ESD Kahler Basin 07/27/2011 17785.00000 44-50-56.6 N OR NE 119-47-33.8 W 0004818300 North Central ESD Spray 07/27/2011 19345.00000 44-50-04.2 N Page 4 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR NE 120-02-52.1 W 0004818375 North Central ESD Keys Mountain 07/27/2011 10755.00000 44-34-12.2 N OR NE 120-08-48.3 W 0004818386 North Central ESD Mitchell 07/27/2011 11245.00000 44-33-51.1 N OR NE 120-48-33.2 W 0004820719 North Central
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308856A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308856A1.txt
  • SPECTRUM HOLDINGS III, LLC 22225.00000000 Dallas 32-44-31.2 N TX 96-41-2.0 W 1 1 06/29/2011 WQLE610 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17965.00000000 Dallas 32-44-31.2 N TX 96-41-2.0 W 3 1 06/29/2011 WQLE610 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 18065.00000000 Dallas 32-44-31.2 N TX 96-41-2.0 W 3 1 06/30/2011 WQLE637 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 10775.00000000 Plano 33-2-31.2 N TX 96-43-4.2 W 2 1 06/30/2011 WQLE637 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 10895.00000000 Plano 33-2-31.2 N TX 96-43-4.2 W 2 1 06/30/2011 WQLE637 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17815.00000000 Plano 33-2-31.2 N TX 96-43-4.2 W 4 1 06/30/2011 WQLE637 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17915.00000000 Plano 33-2-31.2 N TX 96-43-4.2 W 4 1 06/30/2011 WQLE642 FXO CLEARWIRE SPECTRUM HOLDINGS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308979A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308979A1.txt
  • Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WY MD WMR704 107-23-19.2 W 0004829450 Union Telephone Company RAWLINS 08/05/2011 06404.79000 41-38-07.9 N WA MD WGW364 120-04-18.2 W 0004829458 Frontier Communications Northwest Inc.WATERVILLE 08/05/2011 11405.00000 47-38-57.4 N WA MD WGW364 120-04-18.2 W 0004829458 Frontier Communications Northwest Inc.WATERVILLE 08/05/2011 11605.00000 47-38-57.4 N WA MD KTF80 120-02-04.2 W 0004829485 Frontier Communications Northwest Inc.CHELAN 08/05/2011 10755.00000 47-48-26.4 N WA MD KTF80 120-02-04.2 W 0004829485 Frontier Communications Northwest Inc.CHELAN 08/05/2011 10915.00000 47-48-26.4 N WA MD KTF80 120-02-04.2 W 0004829485 Frontier Communications Northwest Inc.CHELAN 08/05/2011 11115.00000 47-48-26.4 N WY MD WQDA905 105-18-21.5 W 0004829512 Union Telephone Company DOUGLAS 08/05/2011 05974.85000 42-43-24.5 N WY MD WQDA905 105-18-21.5 W 0004829512 Union Telephone
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309247A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309247A1.txt
  • 08/18/2011 42-20-17.0 N OK MD KNKN471 099-25-42.3 W 0004844749 WWC License L.L.C. Elk City 08/18/2011 35-23-46.2 N OK MD KNKN471 099-48-31.4 W 0004844749 WWC License L.L.C. HOLLIS 08/18/2011 34-44-30.2 N OK MD KNKN471 098-56-51.3 W 0004844749 WWC License L.L.C. Snyder 08/18/2011 34-38-44.5 N NE MD KNKN365 098-00-30.6 W 0004846320 ALLTEL Communications of Nebraska, IncAurora 08/19/2011 40-49-44.8 N NE MD KNKN365 097-47-04.2 W 0004846320 ALLTEL Communications of Nebraska, IncCLARKS 08/19/2011 41-10-56.0 N NE MD KNKN365 097-32-57.8 W 0004846320 ALLTEL Communications of Nebraska, IncOSCEOLA 08/19/2011 41-09-48.6 N NE MD KNKN365 097-10-42.0 W 0004846320 ALLTEL Communications of Nebraska, IncSEWARD 08/19/2011 40-54-39.0 N Page 15 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309249A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309249A1.txt
  • 08/16/2011 11345.00000 39-02-26.3 N MD NE 075-51-50.8 W 0004843130 State of Maryland, MIEMSS Elkton 08/17/2011 06286.19000 39-36-11.5 N MD NE 076-28-01.0 W 0004843136 State of Maryland, MIEMSS BALTIMORE 08/17/2011 06315.84000 39-20-22.0 N MD NE 076-28-01.0 W 0004843136 State of Maryland, MIEMSS BALTIMORE 08/17/2011 06375.14000 39-20-22.0 N MD NE 076-07-43.0 W 0004843147 State of Maryland, MIEMSS Havre de Grace 08/17/2011 06256.54000 39-34-04.2 N MD NE 076-07-43.0 W 0004843147 State of Maryland, MIEMSS Havre de Grace 08/17/2011 06315.84000 39-34-04.2 N MD NE 076-24-33.9 W 0004843152 State of Maryland, MIEMSS Annapolis 08/17/2011 11405.00000 39-00-48.3 N MD NE 076-43-15.8 W 0004843167 State of Maryland, MIEMSS PIKESVILLE 08/17/2011 06197.24000 39-22-33.7 N Page 9 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309336A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309336A1.txt
  • 32-03-21.8 N FL MD KNKN706 082-07-52.9 W 0004848209 New Cingular Wireless PCS, LLC MACCLENNY 08/22/2011 30-16-08.8 N GA MD KNKN706 082-00-58.8 W 0004848209 New Cingular Wireless PCS, LLC MANASSAS 08/22/2011 32-08-43.4 N GA MD KNKN706 082-34-52.5 W 0004848209 New Cingular Wireless PCS, LLC MANOR 08/22/2011 31-06-03.0 N GA MD KNKN706 082-37-03.7 W 0004848209 New Cingular Wireless PCS, LLC MILLWOOD 08/22/2011 31-16-04.2 N Page 25 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA MD KNKN706 082-00-18.3 W 0004848209 New Cingular Wireless PCS, LLC Nahunta 08/22/2011 31-12-29.7 N GA MD KNKN706 082-05-10.1 W 0004848209 New Cingular Wireless PCS, LLC ST. GEORGE 08/22/2011 30-31-18.0 N GA MD KNKN706 082-39-24.7 W 0004848209
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309457A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309457A1.txt
  • N AZ MD KPV76 112-33-35.6 W 0004861992 CNG COMMUNICATIONS, INC. PERRYVILLE 09/01/2011 11665.00000 33-34-10.1 N AZ MD KPV76 112-33-35.6 W 0004861992 CNG COMMUNICATIONS, INC. PERRYVILLE 09/01/2011 17760.00000 33-34-10.1 N AZ MD KPV76 112-33-35.6 W 0004861992 CNG COMMUNICATIONS, INC. PERRYVILLE 09/01/2011 17855.00000 33-34-10.1 N AZ MD KPV76 112-33-35.6 W 0004861992 CNG COMMUNICATIONS, INC. PERRYVILLE 09/01/2011 17865.00000 33-34-10.1 N AK MD WPYS406 149-18-04.2 W 0004862377 ACS of Anchorage License Sub, Inc. Mantanuska 09/01/2011 17905.00000 61-33-45.6 N PR MD WPOU317 065-49-32.1 W 0004862845 T-Mobile Puerto Rico LLC RIO GRANDE 09/02/2011 11275.00000 18-22-28.8 N PR MD WPOU317 065-49-32.1 W 0004862845 T-Mobile Puerto Rico LLC RIO GRANDE 09/02/2011 11345.00000 18-22-28.8 N PR MD WPOU317 065-49-32.1 W 0004862845 T-Mobile Puerto Rico LLC RIO GRANDE 09/02/2011 11385.00000 18-22-28.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309459A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309459A1.txt
  • 47-27-22.6 N NH MD WPSS672 071-29-04.7 W 0004863372 NEW HAMPSHIRE, STATE OF, DIVISIONLaconia 09/02/2011 11148.12500 43-32-35.3 N NH MD WPSS672 071-29-04.7 W 0004863372 NEW HAMPSHIRE, STATE OF, DIVISIONLaconia 09/02/2011 11365.00000 43-32-35.3 N NH MD WPSS672 071-29-04.7 W 0004863372 NEW HAMPSHIRE, STATE OF, DIVISIONLaconia 09/02/2011 11663.12500 43-32-35.3 N NH MD WPSS668 071-22-08.2 W 0004863373 NEW HAMPSHIRE, STATE OF, DIVISIONGILFORD 09/02/2011 06226.89000 43-31-04.2 N NH MD WPSS668 071-22-08.2 W 0004863373 NEW HAMPSHIRE, STATE OF, DIVISIONGILFORD 09/02/2011 06835.62500 43-31-04.2 N NH MD WPSS668 071-22-08.2 W 0004863373 NEW HAMPSHIRE, STATE OF, DIVISIONGILFORD 09/02/2011 11285.00000 43-31-04.2 N NH MD WPSS668 071-22-08.2 W 0004863373 NEW HAMPSHIRE, STATE OF, DIVISIONGILFORD 09/02/2011 11638.12500 43-31-04.2 N NH MD WPQN966 071-41-54.3 W 0004863375 NH DEPT OF SAFETY/STATE POLICE FRANCONIA 09/02/2011 06197.24000
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309561A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309561A1.txt
  • 0004815187 North Central ESD Condon 09/08/2011 21925.00000 45-14-10.0 N OR AM 120-10-55.5 W 0004815195 North Central ESD Condon 09/08/2011 23125.00000 45-14-08.5 N OR AM 120-10-57.6 W 0004815217 North Central ESD Condon 09/08/2011 23035.00000 45-13-54.5 N OR AM 119-46-43.9 W 0004818266 North Central ESD Kahler Basin 09/08/2011 17785.00000 44-50-56.6 N OR AM 119-47-33.8 W 0004818300 North Central ESD Spray 09/08/2011 19345.00000 44-50-04.2 N OR AM 120-02-52.1 W 0004818375 North Central ESD Keys Mountain 09/08/2011 10755.00000 44-34-12.2 N OR AM 120-08-48.3 W 0004818386 North Central ESD Mitchell 09/08/2011 11245.00000 44-33-51.1 N OR AM 120-48-33.2 W 0004820719 North Central ESD Grass Valley 09/08/2011 10735.00000 45-24-39.9 N OR AM 120-48-33.2 W 0004820719 North Central ESD Grass Valley 09/08/2011 10755.00000 45-24-39.9 N OR AM 120-47-12.2 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309688A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309688A1.txt
  • PCS, LLCKingsville 09/15/2011 38-52-01.6 N MO MD KNKN570 093-23-20.9 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCMALTA BEND 09/15/2011 39-11-46.4 N MO MD KNKN570 093-15-15.2 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 09/15/2011 39-06-34.7 N MO MD KNKN570 093-11-14.1 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 09/15/2011 39-08-44.9 N MO MD KNKN570 093-57-28.5 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCOdessa 09/15/2011 39-01-04.2 N MO MD KNKN570 093-15-25.6 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCSEDALIA 09/15/2011 38-40-05.6 N MO MD KNKN570 093-16-34.1 W 0004876241 NEW CINGULAR WIRELESS PCS, LLCSEDALIA 09/15/2011 38-44-46.1 N Page 20 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD KNKN570 093-37-59.1 W 0004876241 NEW CINGULAR WIRELESS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309881A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309881A1.txt
  • MD KNKN739 079-57-34.3 W 0004879390 New Cingular Wireless PCS, LLC PUMPKINTOWN 09/19/2011 38-57-07.4 N WV MD KNKN739 080-32-33.7 W 0004879390 New Cingular Wireless PCS, LLC RICHWOOD 09/19/2011 38-12-43.3 N WV MD KNKN739 080-19-38.0 W 0004879390 New Cingular Wireless PCS, LLC ROCK CAVE 09/19/2011 38-51-01.0 N WV MD KNKN739 080-39-59.7 W 0004879390 New Cingular Wireless PCS, LLC Rollyson (Gabel Kno 09/19/2011 38-47-04.2 N WV MD KNKN739 080-01-22.3 W 0004879390 New Cingular Wireless PCS, LLC Snowshoe 09/19/2011 38-26-29.8 N WV MD KNKN739 080-01-24.0 W 0004879390 New Cingular Wireless PCS, LLC SNOWSHOE 09/19/2011 38-26-30.0 N WV MD KNKN739 080-52-08.7 W 0004879390 New Cingular Wireless PCS, LLC Summervile 09/19/2011 38-16-47.5 N WV MD KNKN739 080-42-31.6 W 0004879390 New Cingular Wireless PCS, LLC SUTTON 09/19/2011 38-38-57.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309884A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309884A1.txt
  • MOBILNET OF CALIFORNIA LIMITEARROYO GRANDE 09/23/2011 11115.00000 35-06-25.0 N CA MD WLL866 120-31-01.0 W 0004885384 GTE MOBILNET OF CALIFORNIA LIMITEARROYO GRANDE 09/23/2011 11155.00000 35-06-25.0 N CA MD WLL866 120-31-01.0 W 0004885384 GTE MOBILNET OF CALIFORNIA LIMITEARROYO GRANDE 09/23/2011 11215.00000 35-06-25.0 N CA MD WLL866 120-31-01.0 W 0004885384 GTE MOBILNET OF CALIFORNIA LIMITEARROYO GRANDE 09/23/2011 11325.00000 35-06-25.0 N OH MD WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 05974.85000 41-21-59.5 N OH MD WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 06073.68000 41-21-59.5 N OH MD WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 06103.33000 41-21-59.5 N OH MD WPUG348 083-43-47.4 W 0004885528 LINK Investments, LTD. TOLEDO 09/23/2011 06226.89000 41-41-11.9 N WA MD WPJB542 119-53-04.1 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310261A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310261A1.txt
  • more than 80% Greater than 80 and no more than 100% 100% or more aDSL 0.6 2.2 6.6 29.1 28.6 19.4 8.8 2.8 1.2 0.2 0.5 sDSL 83.2 15.7 0.7 0.1 0.3 0.0 0.0 0.0 0.0 0.0 0.0 Other Wireline 94.7 5.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Cable Modem 14.1 10.1 10.4 19.0 17.9 13.4 8.8 4.2 1.8 0.1 0.0 FTTP 63.7 26.5 3.4 2.8 1.8 1.0 0.6 0.2 0.2 0.0 0.0 Satellite 0.8 86.5 10.5 2.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 50.1 39.8 6.0 3.3 0.6 0.2 0.1 0.0 0.0 0.0 0.0 Power Line 99.5 0.5 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 All Other 99.8 0.2 0.0 0.0 0.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310264A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310264A1.txt
  • Competition: Status as of December 31, 2010 28 Zero 17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% 7.1% 6.9% One 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 8.7 8.6 Two 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 7.4 7.6 Three 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 6.2 6.3 Four 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 5.2 5.5 Five 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 4.7 5.0 Six 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 4.2 4.2 Seven 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 3.6 3.7 Eight 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 3.4 3.5 Nine 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 2.8 3.0 Ten or More 35.3 34.0 33.5 33.1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310319A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310319A1.txt
  • NE 104-47-41.1 W 0004905411 Denver International Airport Denver 10/07/2011 11185.00000 39-46-03.5 N WA RM WPNA311 118-57-47.6 W 0004900293 MULTI AGENCY COMMUNICATIONS CTCOULEE DAM 10/05/2011 05974.85000 47-57-39.0 N WA RM WPNA311 118-57-47.6 W 0004900293 MULTI AGENCY COMMUNICATIONS CTCOULEE DAM 10/05/2011 06123.10000 47-57-39.0 N WA RM WPNA311 118-57-47.6 W 0004900293 MULTI AGENCY COMMUNICATIONS CTCOULEE DAM 10/05/2011 06745.00000 47-57-39.0 N WA RM WPNA314 119-20-04.2 W 0004902433 MULTI AGENCY COMMUNICATIONS CTMOSES LAKE 10/05/2011 05945.20000 47-10-51.4 N Page 13 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA RM WPNA314 119-20-04.2 W 0004902433 MULTI AGENCY COMMUNICATIONS CTMOSES LAKE 10/05/2011 06123.10000 47-10-51.4 N WA RM WPNA314 119-20-04.2 W 0004902433 MULTI AGENCY COMMUNICATIONS
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310454A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310454A1.txt
  • the Communications Act of 1934, as amended, that were accepted for filing. MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MN AM WPQL863 092-45-01.1 W 0004863044 Minnesota, State of Cusson 10/12/2011 06741.25000 48-10-47.5 N MN AM 091-02-03.1 W 0004863337 Minnesota, State of Schroeder 10/12/2011 05945.20000 47-36-04.2 N MN AM 091-02-03.1 W 0004863337 Minnesota, State of Schroeder 10/12/2011 06004.50000 47-36-04.2 N MN AM 091-02-03.1 W 0004863337 Minnesota, State of Schroeder 10/12/2011 06315.84000 47-36-04.2 N MN AM 091-02-03.1 W 0004863337 Minnesota, State of Schroeder 10/12/2011 06375.14000 47-36-04.2 N LA AM 090-30-14.0 W 0004866810 Governors Office of Homeland Security & Amite 10/11/2011 11305.00000 30-43-38.9 N LA AM 090-30-14.0 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310475A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310475A1.txt
  • Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. IG - Industrial/Business Pool, Conventional Mobility Division 09/15/2011 WNXK295 MO PROSPECT HIGH SCHOOL 464.47500000 -- -- 4 1 09/15/2011 WNXK295 MO PROSPECT HIGH SCHOOL 469.47500000 -- -- 4 1 09/14/2011 WPHG722 MO SEMINOLE COUNTY PUBLIC SCHOOLS 452.17500000 SANFORD 28-48-50.0 N FL 81-16-4.2 W 1 1 09/14/2011 WPHG722 MO SEMINOLE COUNTY PUBLIC SCHOOLS 452.80000000 SANFORD 28-48-50.0 N FL 81-16-4.2 W 1 1 09/14/2011 WPHG722 MO SEMINOLE COUNTY PUBLIC SCHOOLS 461.10000000 SANFORD 28-48-50.0 N FL 81-16-4.2 W 1 1 09/14/2011 WPHG722 MO SEMINOLE COUNTY PUBLIC SCHOOLS 462.27500000 SANFORD 28-48-50.0 N FL 81-16-4.2 W 1 1 09/14/2011 WPHG722 MO SEMINOLE COUNTY PUBLIC SCHOOLS 462.40000000 SANFORD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310633A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310633A1.txt
  • KNKA351 118-23-32.1 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCRANCHO PALOS V 10/18/2011 33-45-48.6 N CA MD KNKA351 117-42-00.6 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 10/18/2011 35-28-40.3 N CA MD KNKA351 117-38-01.5 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 10/18/2011 35-37-17.2 N CA MD KNKA351 114-09-56.1 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCSAN BERNARDINO 10/18/2011 34-18-33.7 N CA MD KNKA351 117-36-04.2 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 10/18/2011 33-24-36.4 N CA MD KNKA351 117-36-59.2 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 10/18/2011 33-25-49.3 N CA MD KNKA351 117-37-18.3 W 0004915146 NEW CINGULAR WIRELESS PCS, LLCSAN CLEMENTE 10/18/2011 33-26-25.9 N Page 28 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310635A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310635A1.txt
  • 096-51-13.7 W 0004914290 City of Carrollton, Texas Carrollton 10/17/2011 23225.00000 33-01-13.1 N TX MD WQJZ510 096-53-21.1 W 0004914301 City of Carrollton, Texas CARROLLTON 10/17/2011 19525.00000 32-58-34.8 N TX MD WQHD776 096-51-23.7 W 0004914309 City of Carrollton, Texas Carrollton 10/17/2011 17815.00000 32-58-22.9 N TX MD WQHD776 096-51-23.7 W 0004914309 City of Carrollton, Texas Carrollton 10/17/2011 17965.00000 32-58-22.9 N TX MD WQAY602 096-55-04.2 W 0004914322 City of Carrollton, Texas Carrollton 10/17/2011 19325.00000 32-56-55.9 N TX MD WQAY602 096-55-04.2 W 0004914322 City of Carrollton, Texas Carrollton 10/17/2011 19475.00000 32-56-55.9 N TX MD WQEC352 096-53-28.1 W 0004914328 City of Carrollton, Texas Addison 10/17/2011 17915.00000 32-58-40.6 N CA MD WEF731 118-20-10.2 W 0004916606 LOS ANGELES, CITY OF Rancho Palos Verde 10/19/2011 06815.00000 33-44-46.0 N CA MD
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310654A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310654A1.txt
  • W1 1 09/16/2011 WQLN618 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11665.00000000 Northridge 34-14-6.8 N CA 118-33-50.3 W1 1 09/16/2011 WQLN618 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11345.00000000 Northridge 34-14-6.8 N CA 118-33-50.3 W2 1 09/16/2011 WQLN618 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11425.00000000 Northridge 34-14-6.8 N CA 118-33-50.3 W2 1 09/16/2011 WQLN619 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21875.00000000 Lynwood 33-56-4.2 N CA 118-13-32.2 W1 1 09/16/2011 WQLN619 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 22025.00000000 Lynwood 33-56-4.2 N CA 118-13-32.2 W1 1 09/16/2011 WQLN624 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19575.00000000 Sherman Oaks 34-9-5.5 N CA 118-27-14.8 W1 1 Page 10 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ##
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310779A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310779A1.txt
  • WQLP742 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11625.00000000 ANTIOCH 36-3-49.6 N TN 86-39-13.4 W 2 1 09/23/2011 WQLP742 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11465.00000000 ANTIOCH 36-3-49.6 N TN 86-39-13.4 W 3 1 09/23/2011 WQLP742 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11625.00000000 ANTIOCH 36-3-49.6 N TN 86-39-13.4 W 3 1 09/23/2011 WQLP778 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11565.00000000 ATWATER 37-22-4.2 N CA 120-34-56.1 W3 1 09/24/2011 WQLP827 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17920.00000000 Houston 29-49-28.7 N TX 95-15-29.8 W 5 1 09/24/2011 WQLP834 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 10775.00000000 POTOMAC 39-1-32.5 N MD 77-9-3.4 W 1 1 09/24/2011 WQLP834 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 10895.00000000 POTOMAC 39-1-32.5 N MD 77-9-3.4 W 1 1 09/24/2011 WQLP834 FXO CLEARWIRE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310781A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310781A1.txt
  • 19375.00000 32-48-09.3 N CA NE 122-01-09.4 W 0004924915 Wiline Networks Inc Sunnyvale 10/24/2011 19675.00000 37-24-20.4 N CA NE 122-06-04.0 W 0004924969 Wiline Networks Inc Palo Alto 10/24/2011 17915.00000 37-25-19.3 N CA NE 122-02-57.9 W 0004925051 Wiline Networks Inc Cupertino 10/24/2011 11215.00000 37-18-59.2 N IA NE 092-29-29.3 W 0004925063 USCOC OF GERATER IOWA, LLC WAVERLY 10/24/2011 06345.49000 42-42-16.8 N CA NE 118-23-04.2 W 0004925070 Bel Air Internet West Hollywood 10/24/2011 17965.00000 34-05-03.1 N IA NE 092-11-53.9 W 0004925071 USCOC OF GREATER IOWA, LLC READLYN 10/24/2011 06785.00000 42-42-44.0 N IA NE 092-19-06.7 W 0004925080 USCOC OF GREATER IOWA, LLC Denver 10/24/2011 06745.00000 42-39-43.5 N CA NE 118-29-34.0 W 0004925092 Bel Air Internet Santa Monica 10/24/2011 19575.00000 34-00-32.2 N Page 20 CF - Common
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310782A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310782A1.txt
  • 118-17-36.2 W 0004931511 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 10/28/2011 23325.00000 34-03-41.1 N CA MD WQLU698 118-17-36.2 W 0004931511 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 10/28/2011 23425.00000 34-03-41.1 N CA MD WQLU698 118-17-36.2 W 0004931511 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 10/28/2011 23475.00000 34-03-41.1 N CA MD WQLU698 118-17-36.2 W 0004931511 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 10/28/2011 23525.00000 34-03-41.1 N CA MD WQMZ935 117-45-04.2 W 0004931514 CLEARWIRE SPECTRUM HOLDINGS IIILa Verne 10/28/2011 10775.00000 34-07-18.2 N CA MD WQMZ935 117-45-04.2 W 0004931514 CLEARWIRE SPECTRUM HOLDINGS IIILa Verne 10/28/2011 10855.00000 34-07-18.2 N Page 4 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQMZ935 117-45-04.2 W 0004931514 CLEARWIRE SPECTRUM HOLDINGS IIILa
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311024A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311024A1.txt
  • 11425.00000 39-08-44.3 N NC MD WQJE788 082-39-05.4 W 0004942835 Buncombe County North Carolina Asheville 11/08/2011 17815.00000 35-36-04.3 N NC MD WQJE788 082-39-05.4 W 0004942835 Buncombe County North Carolina Asheville 11/08/2011 17875.00000 35-36-04.3 N NC MD WQJE791 082-32-45.9 W 0004942876 Buncombe County North Carolina Asheville 11/08/2011 19435.00000 35-35-58.2 N MN MD WPQL516 093-33-54.5 W 0004943170 HENNEPIN, COUNTY OF Rogers 11/08/2011 10715.00000 45-12-04.2 N MN MD WPQL516 093-33-54.5 W 0004943170 HENNEPIN, COUNTY OF Rogers 11/08/2011 10795.00000 45-12-04.2 N NJ MD WQKJ677 074-05-33.8 W 0004943171 COUNTY OF BERGEN, BERGEN COUNTCarlstadt 11/08/2011 06675.00000 40-50-34.0 N NJ MD WQKJ677 074-05-33.8 W 0004943171 COUNTY OF BERGEN, BERGEN COUNTCarlstadt 11/08/2011 11325.00000 40-50-34.0 N NJ MD WQKJ672 074-10-56.4 W 0004943174 COUNTY OF BERGEN, BERGEN COUNTMAHWAH 11/08/2011 10995.00000 41-03-22.3 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311026A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311026A1.txt
  • 0004941864 New Cingular Wireless PCS, LLC MISSOULA 11/07/2011 46-48-41.0 N MT MD KNKN308 111-55-57.0 W 0004941864 New Cingular Wireless PCS, LLC Montana City 11/07/2011 46-30-37.1 N MT MD KNKN308 114-08-07.4 W 0004941864 New Cingular Wireless PCS, LLC ORCHARD HOMES 11/07/2011 47-03-51.5 N MT MD KNKN308 114-51-34.0 W 0004941864 New Cingular Wireless PCS, LLC Paradise 11/07/2011 47-22-22.0 N MT MD KNKN308 113-15-04.2 W 0004941864 New Cingular Wireless PCS, LLC Philipsburg 11/07/2011 46-15-50.7 N MT MD KNKN308 113-03-27.7 W 0004941864 New Cingular Wireless PCS, LLC Philipsburg 11/07/2011 46-32-03.0 N MT MD KNKN308 114-16-08.4 W 0004941864 New Cingular Wireless PCS, LLC Polson 11/07/2011 47-46-25.4 N MT MD KNKN308 113-31-56.3 W 0004941864 New Cingular Wireless PCS, LLC SEELEY LAKE 11/07/2011 47-09-55.8 N MT MD KNKN308
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311141A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311141A1.txt
  • OK MD KKQ36 095-54-12.9 W 0004954247 Public Service Company of Oklahoma Tulsa 11/15/2011 06256.54000 36-06-50.3 N OK MD KKQ36 095-54-12.9 W 0004954247 Public Service Company of Oklahoma Tulsa 11/15/2011 06315.84000 36-06-50.3 N OK MD KKQ36 095-54-12.9 W 0004954247 Public Service Company of Oklahoma Tulsa 11/15/2011 06811.25000 36-06-50.3 N CA MD WQLP778 120-34-56.1 W 0004954321 CLEARWIRE SPECTRUM HOLDINGS IIIATWATER 11/15/2011 11265.00000 37-22-04.2 N CA MD WQLP778 120-34-56.1 W 0004954321 CLEARWIRE SPECTRUM HOLDINGS IIIATWATER 11/15/2011 11485.00000 37-22-04.2 N CA MD WQLP778 120-34-56.1 W 0004954321 CLEARWIRE SPECTRUM HOLDINGS IIIATWATER 11/15/2011 19525.00000 37-22-04.2 N CA MD WQLP778 120-34-56.1 W 0004954321 CLEARWIRE SPECTRUM HOLDINGS IIIATWATER 11/15/2011 19575.00000 37-22-04.2 N CA MD WQLP778 120-34-56.1 W 0004954321 CLEARWIRE SPECTRUM HOLDINGS IIIATWATER 11/15/2011 19625.00000 37-22-04.2 N CA MD WQLP778
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311481A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311481A1.txt
  • WCP38 116-16-09.2 W 0004984712 State of Nevada Department of InformatioCARLIN 12/08/2011 06725.00000 40-43-06.6 N NV MD WCP38 116-16-09.2 W 0004984712 State of Nevada Department of InformatioCARLIN 12/08/2011 06835.00000 40-43-06.6 N NV MD WCP38 116-16-09.2 W 0004984712 State of Nevada Department of InformatioCARLIN 12/08/2011 06865.00000 40-43-06.6 N NV MD WQGL495 118-43-46.0 W 0004984714 State of Nevada Department of InformatioLovelock 12/08/2011 05974.85000 40-07-04.2 N NV MD WQGL495 118-43-46.0 W 0004984714 State of Nevada Department of InformatioLovelock 12/08/2011 06034.15000 40-07-04.2 N NV MD WQGL495 118-43-46.0 W 0004984714 State of Nevada Department of InformatioLovelock 12/08/2011 06152.75000 40-07-04.2 N NV MD WQGL497 119-27-40.2 W 0004984716 State of Nevada Department of InformatioNixon 12/08/2011 06093.45000 39-45-21.6 N NV MD WQGL497 119-27-40.2 W 0004984716 State of Nevada Department of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311482A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311482A1.txt
  • NE 078-28-14.5 W 0004980191 Conterra Ultra Broadband LLC Four Oaks 12/05/2011 05945.20000 35-20-31.3 N NC NE 078-28-14.5 W 0004980191 Conterra Ultra Broadband LLC Four Oaks 12/05/2011 10795.00000 35-20-31.3 N SC NE 081-18-20.8 W 0004980192 Conterra Ultra Broadband LLC LITTLE MOUNTAIN 12/05/2011 11365.00000 34-12-22.6 N NC NE 078-36-21.6 W 0004980194 Conterra Ultra Broadband LLC Dunn 12/05/2011 11285.00000 35-18-43.2 N TN NE 086-31-04.2 W 0004980223 New Cingular Wireless PCS, LLC GALLATIN 12/05/2011 11325.00000 36-20-30.0 N TN NE 086-31-04.2 W 0004980223 New Cingular Wireless PCS, LLC GALLATIN 12/05/2011 11365.00000 36-20-30.0 N MD NE 076-53-46.7 W 0004980377 airBand Communications, Inc. Greenbelt 12/05/2011 11085.00000 39-00-24.0 N KY NE 083-46-12.6 W 0004980557 New Cingular Wireless PCS, LLC MEANS 12/05/2011 05974.85000 37-57-38.2 N Page 18 CF - Common
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311483A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311483A1.txt
  • MD WLW422 094-18-20.1 W 0004985851 MISSOURI RSA 9B1 LIMITED PARTNERBUTLER 12/09/2011 05974.85000 38-13-23.0 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD WLW422 094-18-20.1 W 0004985851 MISSOURI RSA 9B1 LIMITED PARTNERBUTLER 12/09/2011 06795.00000 38-13-23.0 N MO MD WLU513 094-25-04.2 W 0004985869 New Cingular Wireless PCS, LLC PECULIAR 12/09/2011 05945.20000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0004985869 New Cingular Wireless PCS, LLC PECULIAR 12/09/2011 05974.85000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0004985869 New Cingular Wireless PCS, LLC PECULIAR 12/09/2011 06034.15000 38-43-20.4 N AZ MD WLC867 111-08-44.3 W 0004985905 Verizon Wireless (VAW) LLC Marana 12/09/2011 05974.85000 32-23-20.2 N AZ
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311523A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311523A1.txt
  • IDAHO 89.5 96.0 6.6 * ILLINOIS 95.0 94.7 -0.3 INDIANA 90.3 91.9 1.6 IOWA 95.4 97.9 2.6 KANSAS 94.9 97.7 2.8 KENTUCKY 86.9 94.9 7.9 * LOUISIANA 88.9 98.0 9.0 * MAINE 90.7 97.7 7.0 * MARYLAND 96.3 95.1 -1.2 MASSACHUSETTS 94.3 97.0 2.7 MICHIGAN 93.8 96.9 3.1 MINNESOTA 96.4 97.9 1.6 MISSISSIPPI 82.4 96.8 14.4 * MISSOURI 92.1 96.2 4.2 MONTANA 92.8 95.0 2.3 NEBRASKA 94.0 97.6 3.6 NEVADA 89.4 97.9 8.5 * NEW HAMPSHIRE 95.0 98.3 3.3 NEW JERSEY 94.1 96.6 2.5 NEW MEXICO 85.3 92.0 6.7 NEW YORK 90.8 94.6 3.7 * NORTH CAROLINA 89.3 95.4 6.1 * NORTH DAKOTA 95.1 98.5 3.4 OHIO 92.2 96.7 4.5 * OKLAHOMA 91.5 95.1 3.6 OREGON 91.2 97.7 6.5 * PENNSYLVANIA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311602A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311602A1.txt
  • Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MN MD KNKN450 096-10-38.2 W 0004988246 New Cingular Wireless PCS, LLC Madison 12/12/2011 44-56-05.3 N MN MD KNKN450 096-12-46.5 W 0004988246 New Cingular Wireless PCS, LLC Madison 12/12/2011 45-01-22.8 N MN MD KNKN450 095-49-31.1 W 0004988246 New Cingular Wireless PCS, LLC Marshall 12/12/2011 44-19-39.9 N MN MD KNKN450 095-06-04.2 W 0004988246 New Cingular Wireless PCS, LLC Redwood Falls 12/12/2011 44-32-42.8 N MN MD KNKN450 095-20-07.6 W 0004988246 New Cingular Wireless PCS, LLC Revere 12/12/2011 44-14-45.2 N MN MD KNKN450 095-10-11.7 W 0004988246 New Cingular Wireless PCS, LLC Sanborn 12/12/2011 44-15-13.9 N MN MD KNKN450 095-39-18.2 W 0004988246 New Cingular Wireless PCS, LLC Tracy 12/12/2011 44-13-30.0 N MN MD KNKN450
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311727A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311727A1.txt
  • MD KNKA732 111-40-29.2 W 0005000981 New Cingular Wireless PCS, LLC Power 12/21/2011 47-45-23.8 N MT MD KNKA732 110-16-28.8 W 0005000981 New Cingular Wireless PCS, LLC Stanford 12/21/2011 47-10-02.5 N MT MD KNKA732 110-51-22.1 W 0005000981 New Cingular Wireless PCS, LLC W Sulphur Spring 12/21/2011 46-27-43.4 N MT MD KNKA732 112-06-13.3 W 0005000981 New Cingular Wireless PCS, LLC Wolf Creek 12/21/2011 47-00-04.2 N Page 38 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WPJR589 A 0004997115 NORTH SLOPE TELECOM INC 12/19/2011 00466.37500 AK MD WPJR589 149-43-13.9 W 0004997115 NORTH SLOPE TELECOM INC ANCHORAGE 12/19/2011 00461.37500 61-06-46.0 N MD WPUX358 A 148-26-08.0 W 0004997143 NORTH SLOPE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311729A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311729A1.txt
  • 0005000089 Towerstream Corp. New York 12/21/2011 22575.00000 40-44-21.6 N NV NE 115-08-51.2 W 0005000090 Towerstream Corp. Las Vegas 12/21/2011 23275.00000 36-10-15.5 N NV NE 115-10-53.3 W 0005000091 Towerstream Corp. Las Vegas 12/21/2011 22075.00000 36-08-44.5 N NV NE 115-08-42.4 W 0005000092 Towerstream Corp. North Las Vegas 12/21/2011 22075.00000 36-12-05.0 N CA NE 118-20-40.3 W 0005000093 Towerstream Corp. Los Angeles 12/21/2011 11035.00000 34-06-04.2 N CA NE 118-23-07.9 W 0005000094 Towerstream Corp. Los Angeles 12/21/2011 10715.00000 34-05-46.2 N CA NE 118-26-20.9 W 0005000095 Towerstream Corp. Los Angeles 12/21/2011 17865.00000 33-59-19.7 N CA NE 118-26-28.1 W 0005000096 Towerstream Corp. Los Angeles 12/21/2011 10875.00000 33-59-28.6 N CA NE 118-24-10.1 W 0005000097 Towerstream Corp. Los Angeles 12/21/2011 22225.00000 34-04-17.0 N CA NE 118-26-42.6 W 0005000098 Towerstream Corp.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311775A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311775A1.txt
  • Chart 3.1 Report Chart 2.3 Total High-Cost Support Fund Disbursements and Reserve Table 3.2 Report Table 2.11 High-Cost Support Fund Disbursement History - ILECs and CETCs Chart 3.2 Report Chart 2.4 Total High-Cost Support Fund Disbursements (ILECs and CETCs) and CETC Reserve Tables 3.3 - 3.37 Website Table 4.1 Report Table 2.19 Schools and Libraries Funding Commitments and Disbursements Table 4.2 Report Table 2.20 Schools and Libraries Funding Commitments and Disbursements by State and by Type of Applicant Tables 4.3 - 4.5 Website Tables 4.6 - 4.7 Deleted Chart 4.1 Deleted Table 5.1 Report Table 2.21 Rural Health Care Funding Disbursements by Funding Year Table 5.2 Report Table 2.22 Rural Health Care Funding Commitments and Disbursements by State Tables 5.3 -
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311914A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311914A1.txt
  • NEEDHAM 01/03/2012 21925.00000 42-18-37.0 N MA MD WPVL204 071-15-11.0 W 0005014602 TowerStream Corp WALTHAM 01/03/2012 21920.00000 42-23-20.0 N MA MD WQFI405 071-10-46.0 W 0005014607 Towerstream Corp Woburn 01/03/2012 11485.00000 42-27-19.0 N MA MD WQFI405 071-10-46.0 W 0005014607 Towerstream Corp Woburn 01/03/2012 18015.00000 42-27-19.0 N MA MD WQFU473 071-03-30.0 W 0005014611 Towerstream Corp. BOSTON 01/03/2012 19520.00000 42-21-30.0 N MA MD WQLQ678 071-08-04.2 W 0005014613 Towerstream Corp. Boston 01/03/2012 10995.00000 42-33-20.0 N IL MD WQJH361 087-37-26.8 W 0005014929 Towerstream Corp Chicago 01/04/2012 17755.00000 41-53-55.6 N IL MD WQKG632 087-57-15.0 W 0005014936 Towerstream Corp Chicago 01/04/2012 11185.00000 41-51-29.0 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312139A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312139A1.txt
  • OF JONESBORO 01/17/2012 10755.00000 35-49-30.2 N AR AM WPNN287 090-45-17.9 W 0005006010 ARKANSAS, STATE OF JONESBORO 01/18/2012 10755.00000 35-49-30.2 N MN AM WQOC861 092-48-11.4 W 0005017631 Minnesota, State of Stillwater 01/20/2012 11623.75000 45-02-15.4 N MN AM WQOC861 092-48-11.4 W 0005017631 Minnesota, State of Stillwater 01/20/2012 11628.75000 45-02-15.4 N OH MD WNTD953 081-19-35.3 W 0005032833 Geauga, County of Bainbridge 01/17/2012 10715.00000 41-23-04.2 N OH MD WNTD953 081-19-35.3 W 0005032833 Geauga, County of Bainbridge 01/17/2012 10755.00000 41-23-04.2 N OH MD WNTD953 081-19-35.3 W 0005032833 Geauga, County of Bainbridge 01/17/2012 10795.00000 41-23-04.2 N OH MD WNTD953 081-19-35.3 W 0005032833 Geauga, County of Bainbridge 01/17/2012 10875.00000 41-23-04.2 N OH MD WNTD954 081-03-34.3 W 0005032835 Geauga, County of PARKMAN 01/17/2012 05945.20000 41-24-28.2 N OH MD WNTD954
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312140A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312140A1.txt
  • New Cingular Wireless PCS, LLC HARLOWTON 01/18/2012 46-20-55.1 N MT MD KNKN431 112-00-13.0 W 0005033224 New Cingular Wireless PCS, LLC Jefferson City 01/18/2012 46-24-09.8 N MT MD KNKN431 109-44-32.2 W 0005033224 New Cingular Wireless PCS, LLC Judith Gap 01/18/2012 46-41-17.3 N MT MD KNKN431 111-55-57.0 W 0005033224 New Cingular Wireless PCS, LLC Montana City 01/18/2012 46-30-37.0 N MT MD KNKN431 113-15-04.2 W 0005033224 New Cingular Wireless PCS, LLC Philipsburg 01/18/2012 46-15-50.7 N MT MD KNKN431 109-28-40.0 W 0005033224 New Cingular Wireless PCS, LLC Shawmut 01/18/2012 46-20-55.9 N MT MD KNKN431 110-16-28.7 W 0005033224 New Cingular Wireless PCS, LLC Stanford 01/18/2012 47-10-02.6 N Page 22 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312324A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312324A1.txt
  • 097-32-53.7 W 0005052664 New Cingular Wireless PCS, LLC Spencer 01/30/2012 43-42-12.0 N SD MD KNKN273 096-46-03.1 W 0005052664 New Cingular Wireless PCS, LLC Spink 01/30/2012 42-59-19.7 N SD MD KNKN273 097-49-59.7 W 0005052664 New Cingular Wireless PCS, LLC Springfield 01/30/2012 42-52-51.9 N SD MD KNKN273 097-36-25.2 W 0005052664 New Cingular Wireless PCS, LLC Tabor 01/30/2012 42-55-18.8 N SD MD KNKN273 096-50-04.2 W 0005052664 New Cingular Wireless PCS, LLC TEA 01/30/2012 43-27-08.9 N SD MD KNKN273 097-22-34.2 W 0005052664 New Cingular Wireless PCS, LLC TURKEY RIDGE 01/30/2012 43-14-38.0 N SD MD KNKN273 096-54-33.4 W 0005052664 New Cingular Wireless PCS, LLC Vermillion 01/30/2012 42-47-44.9 N SD MD KNKN273 096-49-13.1 W 0005052664 New Cingular Wireless PCS, LLC VERMILLION 01/30/2012 42-47-12.0 N SD MD KNKN273
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312325A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312325A1.txt
  • N NE MD WQJA306 099-09-35.9 W 0005060015 USCOC NEBRASKA/KANSAS, LLC AXTELL 02/03/2012 06034.15000 40-26-17.2 N NE MD WQJA306 099-09-35.9 W 0005060015 USCOC NEBRASKA/KANSAS, LLC AXTELL 02/03/2012 06595.00000 40-26-17.2 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NE MD WQHK994 098-31-04.2 W 0005060034 USCOC NEBRASKA/KANSAS, LLC Red Cloud 02/03/2012 06226.89000 40-10-29.1 N NE MD WQHK994 098-31-04.2 W 0005060034 USCOC NEBRASKA/KANSAS, LLC Red Cloud 02/03/2012 06545.62500 40-10-29.1 N NE MD WQHK994 098-31-04.2 W 0005060034 USCOC NEBRASKA/KANSAS, LLC Red Cloud 02/03/2012 06585.00000 40-10-29.1 N CA MD WQOH991 117-49-02.8 W 0005060823 New Cingular Wireless PCS, LLC Orange 02/03/2012 11215.00000 33-49-40.3 N NC MD WPNC315
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312417A1.pdf
  • to be incorporated into new infrastructure projects. (2) Support the U.S. government's efforts to facilitate the free flow of data across borders. Work with State, Commerce and the Office of the U.S. Trade Representative to facilitate the interoperability of national/regional networks. Collaborate with other nations on developing ways to facilitate the free flow of data across borders. Outcome-oriented Performance Goal 4.2: Advocate U.S. spectrum interests in the international arena. Targets with Subordinate Measures: (1) Secure international spectrum allocations that allow for new services and protect incumbent services from interference. As appropriate, coordinate and implement action items as adopted at the World Radio Conference (WRC) 2012. Prepare and coordinate proposals with other federal government agencies in preparation for the World Conference on
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312456A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312456A1.txt
  • 02/08/2012 06226.89000 42-13-06.0 N IL MD WNTM373 089-19-34.0 W 0005066821 COMMONWEALTH EDISON COMPANYSEWARD 02/08/2012 06315.84000 42-13-06.0 N IL MD WNTM373 089-19-34.0 W 0005066821 COMMONWEALTH EDISON COMPANYSEWARD 02/08/2012 06638.75000 42-13-06.0 N IL MD WPQX285 089-30-31.0 W 0005066888 COMMONWEALTH EDISON COMPANYMOUNT MORRIS 02/08/2012 05974.85000 42-03-43.0 N IL MD WNTS323 089-56-49.0 W 0005066927 COMMONWEALTH EDISON COMPANYKENT 02/08/2012 06798.75000 42-18-22.0 N CO MD WNTP761 107-47-04.2 W 0005067173 RED CEDAR GATHERING CO DURANGO 02/08/2012 19320.00000 37-22-00.0 N Page 41 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD KJL79 100-55-09.6 W 0005068307 Panhandle Eastern Pipe Line Company, LLIBERAL 02/09/2012 06404.79000 37-03-27.1 N IN MD WHJ962 086-13-18.9 W 0005068315 Panhandle Eastern Pipe
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312690A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312690A1.txt
  • AZ NE 111-14-30.6 W 0005083785 Smith Bagley Inc DBA Cellular One of NE Tuba City S 02/21/2012 19460.00000 36-06-39.1 N CA NE 115-25-17.6 W 0005083833 Verizon Wireless (VAW) LLC Holtville 02/21/2012 11405.00000 32-48-41.5 N WV NE 080-54-17.0 W 0005083845 NEW CINGULAR WIRELESS PCS, LLCFRAMETOWN 02/21/2012 10875.00000 38-37-00.9 N NY NE 074-47-03.5 W 0005083872 Goosetown Network Services LLC LOOMIS 02/21/2012 10715.00000 41-48-04.2 N TX NE 101-58-21.9 W 0005083873 Lubbock SMSA Limited Partnership MIDLAND 02/21/2012 06034.15000 31-49-09.8 N TX NE 101-58-21.9 W 0005083873 Lubbock SMSA Limited Partnership MIDLAND 02/21/2012 06093.45000 31-49-09.8 N Page 22 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 102-03-00.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312691A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312691A1.txt
  • W 0005089227 New Cingular Wireless PCS, LLC BEN WHEELER 02/23/2012 10875.00000 32-26-21.3 N TX NE 095-36-07.1 W 0005089562 NEW CINGULAR WIRELESS PCS, LLCBEN WHEELER 02/23/2012 06315.84000 32-22-41.2 N TX NE 095-36-07.1 W 0005089562 NEW CINGULAR WIRELESS PCS, LLCBEN WHEELER 02/23/2012 11365.00000 32-22-41.2 N TX NE 095-25-01.4 W 0005089715 New Cingular Wireless PCS, LLC TYLER 02/23/2012 06063.80000 32-26-15.0 N UT NE 111-54-04.2 W 0005089787 Digis LLC EDEN 02/23/2012 17815.00000 41-22-51.7 N ID NE 116-31-50.0 W 0005089809 Digis LLC NAMPA 02/23/2012 19680.00000 43-36-10.6 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ID NE 116-44-01.0 W 0005089812 Digis LLC CALDWELL 02/23/2012 19360.00000 43-38-07.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312788A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312788A1.txt
  • 0005093682 California RSA No. 4 Limited PartnershipLE GRAND 02/27/2012 06123.10000 37-10-17.0 N CA MD WPNA980 120-17-01.0 W 0005093682 California RSA No. 4 Limited PartnershipLE GRAND 02/27/2012 06152.75000 37-10-17.0 N Page 6 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD WLU513 094-25-04.2 W 0005093826 New Cingular Wireless PCS, LLC PECULIAR 02/27/2012 05945.20000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0005093826 New Cingular Wireless PCS, LLC PECULIAR 02/27/2012 05974.85000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0005093826 New Cingular Wireless PCS, LLC PECULIAR 02/27/2012 06004.50000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0005093826 New Cingular Wireless PCS, LLC PECULIAR 02/27/2012 06034.15000 38-43-20.4 N
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312789A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312789A1.txt
  • Brandon Communications Inc. VERNDALE 02/29/2012 00464.02500 46-22-05.9 N MD WNFM202 A 0005099151 NAPIER, JOHN DBA MADISON COUNTY 03/01/2012 00461.22500 MD WNFM202 A 0005099151 NAPIER, JOHN DBA MADISON COUNTY 03/01/2012 00466.22500 AR MD WNFM202 X 0005099151 NAPIER, JOHN DBA MADISON COUNTY 03/01/2012 00466.22500 AR MD WNFM202 093-47-05.7 W 0005099151 NAPIER, JOHN DBA MADISON COUNTYHUNTSVILLE 03/01/2012 00461.22500 36-03-24.3 N SC MD WNBE436 079-16-04.2 W 0005101533 MYRTLE BEACH COMMUNICATIONS GEORGETOWN 03/02/2012 00462.87500 33-25-01.6 N SC MD WNBE436 079-16-04.2 W 0005101533 MYRTLE BEACH COMMUNICATIONS GEORGETOWN 03/02/2012 00462.92500 33-25-01.6 N SC MD WNBE436 078-42-34.4 W 0005101533 MYRTLE BEACH COMMUNICATIONS Longs 03/02/2012 00462.87500 33-53-18.2 N SC MD WNBE436 078-42-34.4 W 0005101533 MYRTLE BEACH COMMUNICATIONS Longs 03/02/2012 00462.92500 33-53-18.2 N SC MD WNBE436 079-03-10.0 W 0005101533 MYRTLE BEACH
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.txt
  • 350 to 450 feet (107 to 137 meters). The median number of new registered towers constructed each year from 2006 through 2011 is 2,789 towers (3,732 new towers in 2006; 2,932 in 2007; 2,868 in 2008; 2,709 in 2009; 2,680 in 2010; and 2,013 in 2011). Taking into account that the 2011 figure is likely understated, as discussed in Section 4.2.2 above, this PEA uses 2,800 as a conservative estimate of the number of new registered towers anticipated to be constructed each year over the next 10 years. Although the number of new towers constructed each year may continue to decrease, it is not possible to predict with any certainty what that decrease will be. The continuing growth of the wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312929A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312929A1.txt
  • MD WQKY694 080-42-08.5 W 0005105109 CLEARWIRE SPECTRUM HOLDINGS IIICHARLOTTE 03/06/2012 10935.00000 35-21-05.8 N NC MD WQKY694 080-42-08.5 W 0005105109 CLEARWIRE SPECTRUM HOLDINGS IIICHARLOTTE 03/06/2012 11095.00000 35-21-05.8 N NC MD WQKY688 081-00-59.8 W 0005105110 CLEARWIRE SPECTRUM HOLDINGS IIIMount Holly 03/06/2012 10855.00000 35-17-24.8 N NC MD WQKY688 081-00-59.8 W 0005105110 CLEARWIRE SPECTRUM HOLDINGS IIIMount Holly 03/06/2012 10975.00000 35-17-24.8 N NC MD WQKY541 080-35-04.2 W 0005105111 CLEARWIRE SPECTRUM HOLDINGS IIIMonroe 03/06/2012 11225.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0005105111 CLEARWIRE SPECTRUM HOLDINGS IIIMonroe 03/06/2012 11265.00000 35-01-43.1 N NC MD WQKY541 080-35-04.2 W 0005105111 CLEARWIRE SPECTRUM HOLDINGS IIIMonroe 03/06/2012 11505.00000 35-01-43.1 N GU MD WQKW857 144-48-24.8 E 0005105113 PTI Pacifica Inc. HARMON 03/06/2012 06093.45000 13-30-00.1 N GU MD WQKW857 144-48-24.8 E 0005105113 PTI Pacifica
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312930A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312930A1.txt
  • 0005106518 Aviation Spectrum Resources Inc CHARLESTON 03/07/2012 00129.45000 38-22-00.4 N IN MD KTL9 086-16-48.0 W 0005106519 Aviation Spectrum Resources Inc INDIANAPOLIS 03/07/2012 00129.45000 39-44-00.2 N MO MD KAB2 094-43-00.9 W 0005106526 Aviation Spectrum Resources Inc KANSAS CITY 03/07/2012 00129.45000 39-18-00.0 N MO MD WEZ3 090-21-00.4 W 0005106532 Aviation Spectrum Resources Inc St. Louis 03/07/2012 00129.45000 38-39-00.2 N CA MD WBZ2 124-06-04.2 W 0005106536 Aviation Spectrum Resources Inc ARCATA 03/07/2012 00130.40000 40-58-59.5 N UT MD KPP2 112-09-32.7 W 0005106542 Aviation Spectrum Resources Inc BRYCE CANYON 03/07/2012 00130.40000 37-42-41.4 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City UT MD KPN8 109-45-17.0 W 0005106561 Aviation Spectrum Resources
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312943A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312943A1.txt
  • WQLN579 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11545.00000000 Los Angeles 34-9-59.0 N CA 118-37-24.9 W6 1 02/09/2012 WQLN579 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11305.00000000 Los Angeles 34-9-59.0 N CA 118-37-24.9 W7 1 02/09/2012 WQLN579 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11385.00000000 Los Angeles 34-9-59.0 N CA 118-37-24.9 W7 1 02/09/2012 WQLN619 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 Lynwood 33-56-4.2 N CA 118-13-32.2 W2 1 02/09/2012 WQLN619 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19475.00000000 Lynwood 33-56-4.2 N CA 118-13-32.2 W2 1 02/09/2012 WQLN645 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21825.00000000 Burbank 34-10-45.0 N CA 118-18-4.5 W 3 1 02/09/2012 WQLN645 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21975.00000000 Burbank 34-10-45.0 N CA 118-18-4.5 W 3 1 02/09/2012 WQLN662 FXO CLEARWIRE SPECTRUM
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313091A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313091A1.txt
  • 42-21-04.9 N MA NE 071-02-28.1 W 0005114157 Towerstream Corp. Boston 03/12/2012 10755.00000 42-31-26.1 N MA NE 071-08-25.3 W 0005114158 Towerstream Corp. Providence 03/12/2012 11305.00000 41-41-14.6 N MA NE 071-10-11.4 W 0005114160 Towerstream Corp. Boston 03/12/2012 11135.00000 42-13-27.5 N MA NE 071-08-41.8 W 0005114162 Towerstream Corp. Boston 03/12/2012 17920.00000 42-23-39.8 N MA NE 071-02-57.7 W 0005114163 Towerstream Corp. Boston 03/12/2012 21875.00000 42-21-04.2 N MA NE 071-09-06.6 W 0005114164 Towerstream Corp. Boston 03/12/2012 10895.00000 42-35-39.3 N WV NE 081-14-20.8 W 0005114234 New Cingular Wireless PCS, LLC Bluefield 03/12/2012 11245.00000 37-15-30.0 N WV NE 081-14-20.8 W 0005114234 New Cingular Wireless PCS, LLC Bluefield 03/12/2012 19375.00000 37-15-30.0 N WV NE 081-11-24.7 W 0005114375 New Cingular Wireless PCS, LLC Bluefield 03/12/2012 10755.00000 37-15-51.9 N VA NE
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313092A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313092A1.txt
  • W 0005118352 Zen Networks WEST ORANGE 03/14/2012 10755.00000 40-47-18.0 N NJ NE 074-15-18.0 W 0005118352 Zen Networks WEST ORANGE 03/14/2012 11075.00000 40-47-18.0 N OH NE 082-48-52.0 W 0005118649 Zen Networks, Inc CASTALIA 03/14/2012 11445.00000 41-22-38.0 N OH NE 082-48-52.0 W 0005118649 Zen Networks, Inc CASTALIA 03/14/2012 11565.00000 41-22-38.0 N CA NE 118-19-42.4 W 0005119141 Nextweb Inc Los Angeles 03/15/2012 21820.00000 34-05-04.2 N Page 38 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV NE 115-01-38.6 W 0005119142 Nextweb Inc HENDERSON 03/15/2012 21925.00000 36-02-19.9 N TX NE 102-39-12.2 W 0005119637 ConocoPhillips Communications Inc. Monahans 03/15/2012 00928.58125 31-30-10.0 N TX NE 102-39-12.2 W 0005119637 ConocoPhillips Communications Inc. Monahans 03/15/2012
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313110A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313110A1.txt
  • CLEARWIRE SPECTRUM HOLDINGS III, LLC 17815.00000000 Chino 34-1-37.1 N CA 117-43-38.1 W3 1 02/13/2012 WQLU921 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17915.00000000 Chino 34-1-37.1 N CA 117-43-38.1 W3 1 02/11/2012 WQLU924 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 22025.00000000 LOS ANGELES 33-58-38.1 N CA 118-19-52.5 W4 1 02/10/2012 WQLU926 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23125.00000000 West Covina 34-3-29.6 N CA 117-56-4.2 W 3 1 02/10/2012 WQLU926 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23225.00000000 West Covina 34-3-29.6 N CA 117-56-4.2 W 3 1 02/10/2012 WQLU926 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23025.00000000 West Covina 34-3-29.6 N CA 117-56-4.2 W 4 1 02/10/2012 WQLU926 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23175.00000000 West Covina 34-3-29.6 N CA 117-56-4.2 W 4 1 02/10/2012 WQLU927 FXO
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313253A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313253A1.txt
  • Sioux Falls 03/22/2012 17905.00000 43-36-09.1 N NC NE 080-50-08.3 W 0005130068 CHARLOTTE, CITY OF Charlotte 03/22/2012 11365.00000 35-08-23.0 N NC NE 080-50-08.3 W 0005130068 CHARLOTTE, CITY OF Charlotte 03/22/2012 11525.00000 35-08-23.0 N NC NE 080-48-59.8 W 0005131240 CHARLOTTE, CITY OF Charlotte 03/23/2012 05974.85000 35-03-05.4 N NC NE 080-48-59.8 W 0005131240 CHARLOTTE, CITY OF Charlotte 03/23/2012 11035.00000 35-03-05.4 N NC NE 080-51-04.2 W 0005131424 CHARLOTTE, CITY OF Charlotte 03/23/2012 11245.00000 35-14-04.8 N NC NE 080-51-04.2 W 0005131424 CHARLOTTE, CITY OF Charlotte 03/23/2012 11325.00000 35-14-04.8 N Page 10 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC NE 080-51-04.2 W 0005131424 CHARLOTTE, CITY OF Charlotte 03/23/2012 11565.00000 35-14-04.8
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313254A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313254A1.txt
  • W 0005127037 InfoWest, Inc. Hurricane 03/21/2012 11265.00000 37-10-13.9 N KS NE 094-48-06.9 W 0005127375 Garmin International Olathe 03/21/2012 19425.00000 38-51-23.2 N KS NE 094-53-41.6 W 0005127376 Garmin International New Century 03/21/2012 17865.00000 38-50-31.0 N Page 49 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL NE 087-59-04.2 W 0005127377 Zen Networks, Inc LEMONT 03/21/2012 10795.00000 41-40-16.1 N IL NE 087-59-04.2 W 0005127377 Zen Networks, Inc LEMONT 03/21/2012 10915.00000 41-40-16.1 N IL NE 087-59-04.2 W 0005127377 Zen Networks, Inc LEMONT 03/21/2012 11215.00000 41-40-16.1 N IL NE 087-59-04.2 W 0005127377 Zen Networks, Inc LEMONT 03/21/2012 11405.00000 41-40-16.1 N TX NE 095-26-20.0 W 0005127997 Skynet Communications ROSHARON 03/21/2012 11225.00000 29-19-02.0
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313286A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313286A2.txt
  • 0.0 0.0100.0 35,298,908 0.0 0.0 0.0 0.0100.0 Zambia $1,697,479 0.0 0.0 0.0 18.7 81.3 $54,097 0.0 0.0 0.0 0.0100.0 $428,690 1.7 0.0 0.0 0.0 98.3 18,246,401 0.0 0.0 0.0 25.9 74.1 Zimbabwe $9,856,813 0.0 0.0 0.0 2.4 97.6 $341,985 0.0 0.0 0.0 0.0100.0 $1,739,133 0.9 0.0 0.0 0.0 99.1 42,765,380 0.0 0.0 0.0 2.5 97.5 Africa $395,105,535 0.2 0.0 0.3 4.2 95.3 $13,849,145 0.0 0.0 0.0 0.0100.0 $47,065,054 3.5 0.0 0.0 0.0 96.5 2,682,055,473 0.3 0.0 0.1 5.4 94.1 Bahrain $1,865,267 0.9 0.0 0.0 1.6 97.5 $101,166 0.0 0.0 0.0 0.0100.0 $724,229 5.6 0.0 0.0 0.0 94.4 31,132,030 1.2 0.0 0.0 3.6 95.3 Iran $9,379,717 0.2 0.0 0.1 15.4 84.3 $1,062,017 0.0 0.0 0.0 0.0100.0 $60,28024.7 0.0 0.0 0.0 75.3 133,886,742
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313398A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313398A1.txt
  • 095-21-20.5 W 0005137015 New Cingular Wireless PCS, LLC CONROE 03/27/2012 11305.00000 30-12-26.0 N TX NE 095-25-01.1 W 0005137032 New Cingular Wireless PCS, LLC CONROE 03/27/2012 10815.00000 30-10-29.8 N WA NE 123-35-40.1 W 0005137053 NEW CINGULAR WIRELESS PCS, LLCPORT ANTELES 03/27/2012 10775.00000 48-04-59.6 N PR NE 066-11-45.9 W 0005137102 AT&T Mobility Puerto Rico Inc. Comerio 03/27/2012 11405.00000 18-15-33.3 N TX NE 097-09-04.2 W 0005137952 Cingular Wireless of Texas RSA #16 LimitLEXINGTON 03/28/2012 05974.85000 30-21-05.8 N Page 26 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 122-34-19.0 W 0005138347 New Cingular Wireless PCS, LLC LYNDEN 03/28/2012 10875.00000 48-56-08.4 N WA NE 122-37-22.7 W
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313399A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313399A1.txt
  • N MN MD KNKN421 095-06-24.1 W 0005140330 RCC MINNESOTA, INC. MENAHGA 03/29/2012 46-44-00.9 N Page 19 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MN MD KNKN421 094-38-49.0 W 0005140330 RCC MINNESOTA, INC. MOTLEY 03/29/2012 46-16-30.0 N MN MD KNKN421 096-26-42.9 W 0005140330 RCC MINNESOTA, INC. ORTONVILLE 03/29/2012 45-19-04.2 N MN MD KNKN421 095-13-27.0 W 0005140330 RCC MINNESOTA, INC. Rush Lake 03/29/2012 46-27-59.0 N MN MD KNKN421 095-03-20.1 W 0005140330 RCC MINNESOTA, INC. VERNDALE 03/29/2012 46-23-21.9 N MN MD KNKN422 096-16-22.0 W 0005143491 Midwest Wireless Communications, L.L.CCANBY 03/30/2012 44-42-29.0 N MN MD KNKN422 096-00-45.0 W 0005143491 Midwest Wireless Communications, L.L.CMarshall 03/30/2012 44-26-33.0 N IK - Industrial/Business Pool - Commercial,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313529A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313529A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313529A1.txt
  • and the #2 state for information technology jobs in its 2011 state-by-state index. CNN named New Jersey the fastest growing state for solar energy development in 2011. The New York-Northern New Jersey-Long Island metro area is number one for mobile app-related job growth, containing 9.2 percent of apps economy jobs as of December 2011. New Jersey alone is home to 4.2 percent of apps economy jobs. New Jersey is ranked the #5 state in concentration of mobile app jobs, after California, New York, Washington, and Texas Broadband - and the apps economy - is an enduring engine of growth: Broadband is our innovation infrastructure, enabling collaboration and boosting productivity, and supporting the efficient flow of ideas and knowledge. The U.S. remains
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313615A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313615A1.txt
  • LLC Acton 04/10/2012 10915.00000 34-32-49.6 N KS NE 094-57-26.9 W 0005159593 BNSF Railway Co. Gardner 04/11/2012 06755.00000 38-47-15.9 N TX NE 097-35-17.9 W 0005159814 Electronic Corporate Pages, Inc. WEIR 04/11/2012 17765.00000 30-40-28.7 N TX NE 097-35-17.9 W 0005159814 Electronic Corporate Pages, Inc. WEIR 04/11/2012 18115.00000 30-40-28.7 N UT NE 111-35-26.5 W 0005159816 PacifiCorp Moroni 04/11/2012 06635.62500 39-31-21.8 N TX NE 097-35-04.2 W 0005159819 Electronic Corporate Pages, Inc. WALBURG 04/11/2012 19675.00000 30-43-12.0 N LA NE 093-18-41.9 W 0005159923 Encana Oil & Gas (USA) Inc. Hall Summit 04/11/2012 05945.20000 32-10-43.7 N LA NE 093-18-41.9 W 0005159923 Encana Oil & Gas (USA) Inc. Hall Summit 04/11/2012 06345.49000 32-10-43.7 N Page 47 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313700A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313700A1.txt
  • DBA Cellular One of NE Hard Rock - MB 04/18/2012 10995.00000 36-04-27.3 N AZ NE 110-30-50.2 W 0005170122 Smith Bagley Inc DBA Cellular One of NE Hard Rock - MB 04/18/2012 11035.00000 36-04-27.3 N MD NE 077-43-52.6 W 0005170167 USCOC OF CUMBERLAND, LLC Hagerstown 04/18/2012 10815.00000 39-41-04.1 N GA NE 084-38-17.9 W 0005170238 Verizon Wireless (VAW) LLC RICHLAND 04/18/2012 06286.19000 32-05-04.2 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 117-19-50.0 W 0005170477 Ptera Wireless SPOKANE 04/18/2012 11385.00000 47-42-26.0 N WA NE 117-19-50.0 W 0005170477 Ptera Wireless SPOKANE 04/18/2012 17915.00000 47-42-26.0 N WA NE 117-17-57.1 W 0005170481 Ptera Wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313836A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313836A1.txt
  • High Voltage Communications LLC Chicago 04/24/2012 06226.89000 41-51-11.2 N IN NE 085-01-14.0 W 0005178331 High Voltage Communications LLC ANGOLA 04/24/2012 11325.00000 41-37-15.0 N IN NE 085-39-47.9 W 0005178890 Velox Networks LLC Ligohier 04/25/2012 06226.89000 41-28-23.1 N IN NE 085-39-47.9 W 0005178890 Velox Networks LLC Ligohier 04/25/2012 11185.00000 41-28-23.1 N OH NE 084-45-54.9 W 0005178891 Velox Networks LLC Hicksville 04/25/2012 06375.14000 41-16-04.2 N OH NE 084-45-54.9 W 0005178891 Velox Networks LLC Hicksville 04/25/2012 11155.00000 41-16-04.2 N IN NE 085-13-50.9 W 0005178892 Velox Networks LLC Avilla 04/25/2012 06123.10000 41-21-42.2 N IN NE 085-13-50.9 W 0005178892 Velox Networks LLC Avilla 04/25/2012 11685.00000 41-21-42.2 N OH NE 084-25-06.2 W 0005178895 Velox Networks LLC Junction 04/25/2012 05945.20000 41-11-18.8 N OH NE 084-25-06.2 W 0005178895 Velox Networks
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313951A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313951A1.txt
  • 30-46-22.3 N TX NE 097-27-00.6 W 0005185256 Electronic Corporate Pages, Inc. Holland 04/30/2012 11345.00000 30-53-09.2 N TX NE 097-30-31.2 W 0005185257 Electronic Corporate Pages, Inc. Manor 04/30/2012 10935.00000 30-25-39.5 N TX NE 097-35-17.9 W 0005185258 Electronic Corporate Pages, Inc. Weir 04/30/2012 17765.00000 30-40-28.7 N TX NE 097-35-17.9 W 0005185258 Electronic Corporate Pages, Inc. Weir 04/30/2012 18115.00000 30-40-28.7 N TX NE 097-35-04.2 W 0005185259 Electronic Corporate Pages, Inc. Walburg 04/30/2012 19675.00000 30-43-12.0 N TX NE 097-48-42.1 W 0005185260 Electronic Corporate Pages, Inc. Georgetown 04/30/2012 18015.00000 30-40-27.3 N TX NE 097-48-11.6 W 0005185261 Electronic Corporate Pages, Inc. Florence 04/30/2012 18015.00000 30-52-10.3 N MT NE 106-41-54.7 W 0005185715 BNSF Railway Co. Forsyth 04/30/2012 06765.00000 46-20-07.4 N MT NE 106-41-54.7 W 0005185715 BNSF Railway Co.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-314114A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-314114A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-314114A1.txt
  • waste, fraud and abuse are expected to save $2 billion over three years. Over 13,000 letters were mailed to subscribers in Washington State last week, while another 20,500 letters will be mailed in Missouri this week, and nearly 111,800 more in New York State next week, informing subscribers that they must choose a single provider. The FCC anticipates reviewing another 4.2 million Lifeline records this year. of the program to increase fiscal responsibility and address changes in communications technology. In addition, the FCC on April 1 largely eliminated the ``Link Up'' program, which the Commission concluded had become wasteful and unnecessary. Link Up paid companies up to $30 for initial phone connections even though other companies are now enrolling new subscribers
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-104A1.pdf
  • that allowing carriers merely to "certify a need" is inadequate.169 The current self- certification process, according to the Pennsylvania Commission, resulted in two carriers receiving over 100 central office codes (over one million numbers) upon activation of a new area code in Western Pennsylvania; this, in turn, shortened the projected exhaust date for the new area 163 Id. at § 4.2.1. The CO Code Assignment Certification Worksheet-TN Level MTE Worksheet, set forth in Appendix B to the CO Code Assignment Guidelines, requests data on telephone numbers available for assignment, growth history for the past six months, and projected demand for the coming 12 months. See CO Code Assignment Guidelines at Appendix B n.1. 164 Jeopardy is defined as a situation where
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-208A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-208A1.pdf
  • Commission expand Link Up assistance to cover all charges that an eligible telecommunications carrier may charge to establish service). See, e.g., Eastern Shoshone Tribe comments at 8 (in addition to ``switch activation fee'' of between $33.10-$52.00, carriers charge $375 Rural Network Assessment Tariff plus actual construction costs exceeding $2,300). See US West Communications, Exchange and Network Services Tariff, New Mexico, §§4.2.1, 5.2.4 (1999). See, e.g., Qualcomm comments at 3-4; Motorola/Iridium comments at 7. See Section III.D.2.a., supra, for a further discussion of these issues. See, e.g., Motorola/Iridium comments at 17. Review of Sections 68.104 and 68.213 of the Commission's Rules Concerning Connection of Simple Inside Wiring to the Telephone Network and Petition for Modification of Section 68.213 of the Commission's Rules
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.txt
  • 61.9 Satellite link unavailability for the worst-month % 0.0978 0.3316 0.9361 1.3177 Total link unavailable time for the worst-month minutes 42.8 145.2 421.8 577.1 10% of the unavailable time in the worst-month minutes 4.3 14.5 42.2 57.7 5% of the unavailable time in the worst-month minutes 2.1 7.26 21.1 28.9 2.86% of the unavailable time in the worst-month minutes 1.2 4.2 12.1 16.5 Rainy sky C/I for a 2.86% increase in link unavailability dB 24.2 22.9 25.0 22.3 APPENDIX H -- A METHOD OF CONVERTING PERCENTAGE OF UNAVAILABLE TIME INTO A CARRIER-TO-INTERFERENCE RATIO This appendix presents a method for determining the relationship between DBS service outage time and a DBS system's carrier-to-noise plus interference ratio (C/N+I). Specifically, this method can be
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-448A2.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-448A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-448A2.txt
  • 2000). See Letter from NECA to Magalie Roman Salas, Secretary, FCC (June 21, 2000), transmitting Summary of Results of Broadband Study; Telephony, Communications Daily (June 22, 2000) at 2. See sections 254(b)(3) and (g) of the Act, 47 U.S.C. §§ 254(b)(3), (g). , AT&T One Rate 7¢ Plan; AT&T Communications Tariff FCC No. 27, Optional Calling Plans and Discounts § 4.2 et. seq., listing the companies and their customers to which AT&T offers the optional and discount calling plans. The AT&T list does not include many rural telephone companies and their customers in rural America. See also Stephen Labaton, AT&T Move Means Millions Will Face Higher Phone Bill, New York Times (June 7, 2000) at A1. See Exhibit 2 at 2-17.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-12A1.doc
  • cable systems are held through three entities managed by Time Warner Cable: Time Warner Entertainment (``TWE''), Time Warner Entertainment - Advance/Newhouse Partnership (``TWE-A/N''), and TWI Cable, Inc. (``TWI Cable''). TWE is a limited partnership; Time Warner owns 74.5% of TWE. The remaining 25.5% is owned by AT&T as a result of its purchase of MediaOne Group, Inc. TWE serves approximately 4.2 million basic cable subscribers. TWI Cable, which serves approximately 1.8 million subscribers, is an indirect wholly-owned subsidiary of Time Warner. TWE-A/N is a general partnership owned by TWE, TWI Cable, and Advance/Newhouse Partnership. TWE-A/N serves approximately 6.7 cable million subscribers. Time Warner's partnership interest in TWE-A/N, held through TWE and TWI Cable, totals approximately 67%. Internet Services. Time Warner controls
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-130A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-130A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-130A1.txt
  • interconnection the BOC provided to its own retail operations. See SWBT Texas Order, 15 FCC Rcd at 18380, para. 62. See Massachusetts Department Massachusetts I Comments at 20; D.T.E. Tariff No. 17. See Verizon Massachusetts I Lacouture/Ruesterholz Decl. at para. 8; see also Verizon Massachusetts II Application App. B, Vol. 1, Tab 1A at 18; CLEC Handbook, Vol. III, § 4.2.3.2. See Verizon Massachusetts II Lacouture/Ruesterholz Decl. at paras. 37-38, 187; Verizon Massachusetts II Application App. B, Vol. 1, Tab 2. Verizon has implemented a number of performance measures relating to interconnection, including measures that compare blockage on Verizon common trunk groups with blockage on dedicated trunk groups serving competitive LECs (NP 1-01); measures that capture missed appointments for trunk installations
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.txt
  • boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment used for WDBD services including satellite and earth station equipment 4.23 - All other interexchange circuit equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.3 - Host/Remote Message Circuit Equipment Account
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-272A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-272A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-272A1.txt
  • Motient Petition to Deny Comsat Mobile App. at 20 Motient Petition to Deny at 20. Inmarsat Opposition at 4, Comsat Opposition at 11. Comsat Opposition at 10. Id. at 11. Motient Reply at 13. TMI Order at ¶26. Id. at ¶34. Id. Id. Comsat Corporation, 11 FCC Rcd 8021 (1996), ¶5. 47 C.F.R. § 25.111(b) and ITU Radio Regulations, Article S4.2. See footnote 9, supra. See, e.g. Establishment of Rules and Policies for the Digital Audio Radio Satellite Service in the 2310-2360 MHz Frequency Band, Report and Order and Further Notice, 12 FCC Rcd 5754 (1997). In the Matter of Establishing Rules and Policies for the Use of Spectrum for Mobile Satellite Service in the Upper and Lower L-band, Notice of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-29A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-29A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-29A1.txt
  • trouble report rates of 15.3 percent, 15.9 percent, and 17 percent for the same period. SWBT's Oklahoma performance is reported as 14.3 percent, which is just above the 12 percent benchmark. See SWBT Aggregated Performance Data (Kansas), Measure No. 69-03 (``Repeat Reports - BRI Loop''), at 271-No. 69a. SWBT's trouble report rates for DSL loops provided to competing carriers were 4.2 percent, 1.7 percent, 2.0 percent, and 3.1 percent for the months of July, August, September, and October 2000 respectively. See SWBT Aggregated Performance Data (Kansas), Measure No. 65-08 (``Trouble Report Rate - DSL - No Line Sharing''), at 271-No. 65c; see also SWBT Reply at 64. See SWBT Aggregated Performance Data (Oklahoma), Measure No. 65-08 (``Trouble Report Rate - DSL
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.txt
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. - Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE - Host/Remote Ckt. Eqpt. Inv. N/A 1400 Total COE Cat. 4 - COE Ckt. Eqpt. Inv. N/A 1410
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.txt
  • Sensitive Information. ARTICLE 4: AUDITING, REPORTING, and NOTICE 4.1 Access to Information: In response to reasonable requests made by the FBI or the DOJ, Telenor shall provide in the United States access to information concerning technical, physical, management, or other security measures and other reasonably available information needed by the FBI or the DOJ to assess compliance with this Agreement. 4.2 Visits and Inspections: The FBI and the DOJ may visit any communications facility of Telenor in the United States and may inspect any part of the Domestic Communications Infrastructure in the United States for the purpose of verifying compliance with the terms of this Agreement. Such inspections shall be reasonable in number and be conducted during normal business hours upon
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-108A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-108A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-108A1.txt
  • in the J-Standard would be extremely onerous for carriers because it would require carriers to subvert normal call processing needs and buy additional equipment solely to accommodate surveillance activities. Such a result would not be cost effective. In the words of the statute, post cut-though dialed digits are not reasonably available from the originating carrier'' (emphasis in original). J-STD-025 § 4.2.1. Webster's New World Dictionary, College ed. (1962.) at 101. Although commenters discuss the hardware modifications that will be required to collect this information - i.e. the installation of tone decoders - none argue that the basic structure of the network will not allow for the provision of a dialed digit extraction capability. See also Third R&O, supra n.2, at ¶¶
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.txt
  • the effect on the foreign system(s) is negligible). Id. Comments of EchoStar at 12-13; Comments of Tempo at 3; Comments of USSB at 5. Comments of DIRECTV at 23. See new §25.148(f). See Notice at ¶46. An Administration seeking to modify the Plans must submit to the ITU information requested in Appendix 4 of the ITU Radio Regulations. See Section 4.2.6 of Appendix 30 and Appendix 30A. For DBS systems, the United States must submit Appendix 4 information to notify the ITU Radiocommunication Bureau of the frequencies that will be used for tracking, telemetry and control operations. The ITU Radiocommunication Bureau requests that the Appendix 4 information be submitted in electronic format. See Notice at Appendix A, proposed modified Section 25.114(c)(22)(ii).
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.txt
  • P-5 Average Completion Notice Interval - Mechanized A.2.15 P-5 Average Completion Notice Interval - Non-Mechanized A.2.25 P-11 Service Order Accuracy Maintenance and Repair A.3.1 M&R-1 Missed Repair Appointments A.3.2 M&R-2 Customer Trouble Report Rate A.3.3 M&R-3 Maintenance Average Duration A.3.4 M&R-4 % Repeat Troubles within 30 Days A.3.5 M&R-5 Out of Service > 24 hours Billing A.4.1 B-1 Invoice Accuracy A.4.2 B-2 Mean Time to Deliver Invoices - CRIS UNBUNDLED NETWORK ELEMENTS Ordering B.1.1 O-7/O-13 % Rejected Service Requests - Mechanized B.1.2 O-7/O-13 % Rejected Service Requests - Partially Mechanized B.1.3 O-7/O-13 % Rejected Service Requests - Non-Mechanized B.1.4 O-8/O-14 Reject Interval - Mechanized B.1.7 O-8/O-14 Reject Interval - Partially Mechanized - 10 hours B.1.8 O-8/O-14 Reject Interval - Non-Mechanized B.1.9
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-156A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-156A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-156A1.txt
  • The Complaint asserts that AACR's draft agreement contained pricing terms that differed substantially from those proposed by Tricom S.A. Specifically, AACR's draft agreement allegedly set forth a rate of 1.1 cents per minute for local termination of international calls to Tricom S.A. customers, known as the ``international access charge,'' while Tricom S.A.'s proposed agreement specified an international access charge of 4.2 cents. By May 2001, Tricom S.A. and AACR purportedly had failed to reach an interconnection agreement, and Tricom S.A. still had not activated the T-1 lines that AACR purchased in December 2000. The Complaint avers that, on May 2, 2001, AACR filed a petition with INDOTEL asking INDOTEL to intervene in AACR's interconnection dispute with Tricom S.A. The Complaint advances
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-324A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-324A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-324A1.txt
  • Test'' by C.J. Hall, P.E. and Ivica Kostanic, at 35. In the tables, the 6 dB margin typically equates to the addition of 2 or 3 standard deviations above the mean, which further decreases the likelihood that individual data points might exceed the ITL. A power ratio of 0.61 dB is 1.15:1, about 15%. See n.37. AirTouch stated in section 4.2 of the Lee / Shultz Report (page 13) that ``this data shows that 2% of the time, AirCell is above -106 dBm for 6 second periods. This is the level that drop calls start occurring.'' The data to which this referred, however, was ``all of the data taken in Texas,'' including the July 11 data with AirCell power control disabled.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-331A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-331A1.txt
  • be changes in the metric definition, or changes in the retail analog applied, making it difficult to compare data over time. Metric SQM No.Metric Name Metric SQM No.Metric Name RESALE A.3.5 M&R-5Out of Service > 24 hours Ordering Billing A.1.1 O-7 % Rejected Service Requests ­ Mech. A.4.1 B-1 Invoice Accuracy A.1.2 O-7 % Rejected Service Requests - Partially Mech. A.4.2 B-2 Mean Time to Deliver Invoices ­ CRIS A.1.3 O-7 % Rejected Service Requests - Non-Mech. UNBUNDLED NETWORK ELEMENTS A.1.4 O-8 Reject Interval ­ Mech. Ordering A.1.7 O-8 Reject Interval - Partially Mech. ­ 10 hours B.1.1 O-7/O-13% Rejected Service Requests ­ Mech. A.1.8 O-8 Reject Interval - Non-Mech. B.1.2 O-7/O-13% Rejected Service Requests - Partially Mech. A.1.9 O-9 FOC
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-338A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-338A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-338A1.txt
  • subscriber count for 1997 through 2002 estimated by the FCC. TABLE B-2 Number and Subscriber Size of Major Cable System Clusters (Cumulative Figures) Range of Clustered Subscribers (thousands) 1998 1999 2000 2001 Clusters Subscribers (millions) Clusters Subscribers (millions) Clusters Subscribers (millions) Clusters Subscribers((millions) 100-199 33 4.6 41 5.4 26 3.6 30 4.3 200-299 25 6.3 16 4 13 3.2 17 4.2 300-399 20 6.7 20 6.8 22 7.4 18 6.1 400-499 7 3.2 9 3.9 13 5.9 10 4.4 >500 21 19.6 28 23.8 34 34.3 32 33.3 Total 52.3 Sources: Paul Kagan Associates, Inc., Major Cable TV Systems/Clusters, The Cable TV Financial Databook, 1997, at 39-41; 1998, at 38-42; 1999, at 50-55; 2000 from Kagan World Media, Major Cable TV
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-48A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-48A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-48A1.txt
  • of many operations conducted in restricted bands used for military and public safety applications and other sensitive uses. MCHI requested that UWB devices, other than certain ground radars, not be permitted below 3 GHz. Rockwell requested that UWB devices be prohibited from operating below 5.15 GHz, except for GPRs and wall imaging systems, in order to accommodate radio altimeters at 4.2-4.4 GHz and MLS receivers at 5.03-5.09 GHz. ARRL requested that non-GPRs be located above 2.5 GHz. XM requested that UWB devices be prohibited from operating below 3 GHz in order to provide protection to DARS. Alloy wants all UWB devices, except GPRs, to operate above 2.7 GHz. ARINC & ATA want UWB operation permitted only above 5.5 GHz and then
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-79A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-79A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-79A1.txt
  • the instant order and notice of proposed rulemaking specifically addresses only incumbent LEC PIC-change charges, the proceeding may affect competitive LEC PIC-change charges as well. In addition to residential and business end users, incumbent LECs may also impose PIC-change charges on end-user payphone subscribers when they change their presubscribed IXCs. See, e.g., Ameritech Operating Companies Tariff F.C.C. No. 2, Sec. 4.2(C). PIC-change charges imposed on payphone end-user subscribers are included in the scope of this order and notice of proposed rulemaking. Annual 1985 Access Tariff Filings, CC Docket No. 86-125, Memorandum Opinion and Order, 2 FCC Rcd 1416, 1445-46, paras. 272-74 (1987) (1987 Access Tariff Order). A carrier may, however, establish that a higher PIC-change charge is warranted by providing the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-111A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-111A1.pdf
  • Long Distance Telecommunications Industry (May 2003), Table 14 (released May 14, 2003). For example, measured in access lines, AT&T's residential market share has declined from 74.6 percent in 1995 to 36.7 percent in 2002. Over this time period, the market share for MCI has increased from 13 percent to 15.8 percent, and the market share for Sprint has increased from 4.2 percent to 7.6 percent. Id. at Table 15. According to the Commission report, as of 2002, Verizon had a 9.3 percent share of residential households, SBC had a 3.8 percent share of residential households, and BellSouth had a 0.2 percent share of residential households. The data suggest that the BOCs' market shares vary significantly across regions. Notably, the data suggest
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-127A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-127A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-127A1.txt
  • MOWG Study No. 7, the NAB/NASA study included data on ABC, NBC and CBS, but did not include data on Fox Television. Disney argues that there is no policy-based rationale for excluding Fox stations. Using the NAB/NASA data, but accounting for all four of the networks, Dr. Baumann determined that network-owned stations on average provide more local news -- about 4.2 hours per week -- than do affiliates in all markets. In markets outside the top 25 markets, network-owned stations provide almost eight more hours of local news each week than affiliates do. Inside the top 25 markets, Disney agrees with the NAB/NASA study results that the difference between network-owned stations and affiliates was not statistically significant. In Dr. Baumann's study,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.txt
  • 46.75% 7.6 111 Minot, ND * 111,195 * 7.0 112 Bismarck, ND-MT-SD 73,115 175,427 41.68% 6.3 114 Aberdeen, SD * 82,608 * 5.4 143 Casper, WY-ID-UT 166,979 408,708 40.86% 5.2 115 Rapid City, SD-MT-NE-ND 81,387 213,696 38.09% 5.0 121 North Platte, NE-CO * 61,758 * 5.0 144 Billings, MT-WY 161,907 404,902 39.99% 4.9 145 Great Falls, MT 55,629 166,564 33.40% 4.2 171 Anchorage, AK 285,300 626,932 45.51% 1.0 * Data withheld to maintain firm confidentiality. Source: Federal Communications Commission internal analysis based on preliminary year-end 2002 filings for Numbering Resource Utilization in the United States. Density is persons per square mile. Table 4: Top 25 Mobile Telephone Operators by Subscribers (in thousands) Year-End 2001 Year-End 2002 Operator Total Operator Total 1
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A1.txt
  • include video transmissions operate in this same frequency range. The IS-95 system characteristics that Globalstar proposes as a candidate for its ATC operations allow for higher EIRP levels for base stations than for cdma-2000 base stations. We evaluate the affects of the potentially more interfering ATC network using IS-95 system characteristics. As explained in greater detail in Appendix C3, Section 4.2, the amount of interference caused to BAS equipment is a function of how close (geographically) the ATC base station is located to the BAS receivers of these systems. By selecting certain operating frequencies for the ATC base stations and the BAS assignments, one can simultaneously operate the equipment without causing mutually unacceptable interference at shorter distances. We evaluated the separation
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A1_Erratum.doc
  • include video transmissions operate in this same frequency range. The IS-95 system characteristics that Globalstar proposes as a candidate for its ATC operations allow for higher EIRP levels for base stations than for cdma-2000 base stations. We evaluate the affects of the potentially more interfering ATC network using IS-95 system characteristics. As explained in greater detail in Appendix C3, Section 4.2, the amount of interference caused to BAS equipment is a function of how close (geographically) the ATC base station is located to the BAS receivers of these systems. By selecting certain operating frequencies for the ATC base stations and the BAS assignments, one can simultaneously operate the equipment without causing mutually unacceptable interference at shorter distances. We evaluated the separation
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.txt
  • to meet the same out-of-band emission and position determination requirements as Big LEO MSS systems to respect the fixed-radius protection zones for radio astronomy sites listed in section 25.213 of the Commission's rules and not operate within those zones during periods of radioastronomy observations. This would significantly mitigate any potential interference caused to the RAS from MSS ATC MT operations. 4.2 Inter-Service Sharing 2483.5-2500 MHz 4.2.1 Potential Interference from Big LEO Base Stations to Fixed and Mobile Stations Operating in the 2483.5-2500 MHz Band Over 700 fixed terrestrial stations, including temporary fixed (transportable) stations, were licensed and operating in the United States in the 2483.5-2500 MHz band as of 1994. These stations are primarily used as links in microwave relay systems
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4_Erratum.doc
  • to meet the same out-of-band emission and position determination requirements as Big LEO MSS systems to respect the fixed-radius protection zones for radio astronomy sites listed in section 25.213 of the Commission's rules and not operate within those zones during periods of radioastronomy observations. This would significantly mitigate any potential interference caused to the RAS from MSS ATC MT operations. 4.2 Inter-Service Sharing 2483.5-2500 MHz 4.2.1 Potential Interference from Big LEO Base Stations to Fixed and Mobile Stations Operating in the 2483.5-2500 MHz Band Over 700 fixed terrestrial stations, including temporary fixed (transportable) stations, were licensed and operating in the United States in the 2483.5-2500 MHz band as of 1994. These stations are primarily used as links in microwave relay systems
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-33A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-33A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-33A1.txt
  • UWB operations, except for coordinated terrestrial imaging systems, be located above 5.5 GHz and that the average power limits between 3.1-5.5 GHz be reduced to -51.3 dBm for indoor UWB devices and to -61.3 dBm for handheld UWB devices. They submit that this change is necessary to protect aeronautical telemetry systems (2.31-2.39 GHz), airport surveillance radars (2.7-2.9 GHz), radio altimeters (4.2-4.4 GHz), airborne weather radars (2.9-30., 5.0-5.25, and 5.35-5.47 GHz), and microwave landing systems (5.0-5.25 GHz). They also request that the coordination information for UWB imaging systems be posted on the Internet to permit quick access by licensees and users of licensed services, including GPS users, to enable enforcement of the non-interference requirements. Finally, they request that all UWB devices, particularly
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-3A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-3A2.txt
  • Advanced Interactive (two-way) Digital Cable Products. 4.1. The Parties will agree upon a recognized term for the advanced interactive digital cable products in summary form. The Parties will discuss whether there should be a requirement to mark product in any way with this name, but both MSOs and CE Manufacturers are encouraged to use this name to promote consumer awareness. 4.2. Interoperability Testing and Certification Requirements: Because of the complexity of this type of product, CE Manufacturers agree to a higher level of compliance, and of interoperability testing, leading to self-certification; CE Manufacturers will participate in prototype testing and development of interoperability test suites; further details subject to continued discussion. 4.3. Cable operators' EPG will be provided for advanced interactive digital
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-134A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-134A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-134A1.txt
  • 2223, 2253-2257, ¶¶ 62-73 (2003). See generally MDS/ITFS Order. See infra ¶¶ 75-77. See generally MDS/ITFS Order. See ITU Radio Regulations, Resolution 46, Annex 2.1.2.3.1. 47 C.F.R. § 25.149(a)(2)(iii). In the Big LEO bands, ATC operations are limited to the 1610-1615.5 MHz, 1621.35-1626.5 MHz and 2492.5-2498 MHz bands. Id. See ATC Order, 18 FCC Rcd at 2209, App. C3, § 4.2.2. In that Order, the Commission stated that interference with unlicensed devices is a non-issue because ATC base stations are greater than 25 megahertz from these users. Id. at 2062-2063, ¶ 205. See id. at 2206-2207, App. C3, § 4.2.1; see also 47 C.F.R. § 25.254(a)(3). 47 C.F.R. § 25.255. ATC Order, 18 FCC Rcd at 2057, ¶ 192. See id.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.txt
  • amended, 47 U.S.C. 151, 154(i), 154(j), 154(o), 218, 219, 230, 256, 301, 302(a), 303(f), 303(g), 303(j), 303(r), 403, 621(b)(3), and 621(d), unless otherwise noted. GENERAL § 4.1 Scope, basis and purpose. By these rules the Federal Communications Commission is setting forth requirements pertinent to the reporting of disruptions to communications and to the reliability and security of communications infrastructures. § 4.2 Availability of reports filed under this part. Reports filed under this Part will be presumed to be confidential. Public access to reports filed under this part may be sought only pursuant to the procedures set forth in 47 C.F.R. §0.461. Notice of any requests for inspection of outage reports will be provided pursuant to 47 C.F.R. §0.461(d)(3). § 4.3 Communications
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.txt
  • service on channel 4 and a DTV service on channel 27 would use the major channel 4. The PSIP ``minor channel number'' is used to identify programs and other services, which are a part of the DTV service. For example, channel 4.1 may be an HDTV program service and it may be multiplexed with an SDTV service, which is channel 4.2. According to ATSC, this allows a viewer to easily ``surf'' from, for example, 4.0 (NTSC) to 4.1 (HDTV) to 4.2 (SDTV). ATSC, MSTV/NAB, and others state that the major/minor channel number scheme established in ATSC A/65B will be useful. ATSC states that the PSIP Standard defines specific requirements for use of ``major channel numbers'' to provide viewers with a uniform
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.txt
  • been cloned such that the same key and certificate are found in more than one device or product; (b) a Device Key and/or Device Certificate have been lost, stolen, intercepted, misdirected or made public or disclosed; or (c) revocation is required by court order or other government authority. Id. at 9, n.1; see also id. at Appendix 2 at § 4.2 (``DTCP Adopter Agreement''). See DTCP Adopter Agreement; see also DTCP Certification at Appendix 3 (``DTCP Content Participant Agreement''). DTCP Certification at 16; DTCP Adopter Agreement at §§ 5.3-5.4. DTLA has indicated that it will not enforce its intellectual property rights in DTCP against content owners that use or require use of DTCP without signing the DTCP Content Participant Agreement, so
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-20A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-20A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-20A1.txt
  • amateur-satellite, EESS, FSS, ISS, RAS, radiolocation, and SRS will either increase or remain unchanged. Specifically, the allocation for amateur service will remain unchanged, amateur-satellite service allocation will remain unchanged, EESS allocation will increase by 7.8 gigahertz (from 60 gigahertz to 67.8 gigahertz), FSS allocation will increase by 2 gigahertz (from 53 gigahertz to 55 gigahertz), ISS allocation will increase by 4.2 gigahertz (from 35 gigahertz to 39.2 gigahertz), RAS allocation will increase by 81 gigahertz (from 48 gigahertz to 129 gigahertz), radiolocation allocation will increase by 2.5 gigahertz (from 37 gigahertz to 39.5 gigahertz), and SRS will increase by 24.75 gigahertz (from 60 gigahertz to 84.75 gigahertz). However, due to incompatibility with passive sensor operations, the amount of spectrum allocated for
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-218A1.txt
  • 2004, at 10. Luiz Carvalho et al., A Look at Wireless Data: Don't Short SMS, Morgan Stanley, Equity Research - Wireless Telecom Services, Mar. 2, 2003, at 3. Cingular Wireless reported it had 5 million customers ``actively using'' its mobile data services as of the end of 2002, up from 2 million data customers at the end of 2001. Approximately 4.2 million of the 5 million were accessing data services over Cingular's cellular/PCS networks, and the rest were served by its Mobitex network. Cingular Wireless, LLC, SEC Form 10-K, Mar. 11, 2003, at 3, 5. Verizon Wireless Announces Roll Out of 3G Network in Las Vegas, Press Release, Verizon Wireless, July 27, 2004. AWS Launches UMTS in Four Markets, RCR Wireless
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-246A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-246A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-246A1.txt
  • the AWS Fourth NPRM. Finally, we have deleted the word ``Government'' from any references to Federal Government or non-Federal Government in the footnote. For example, we note that a DOD TT&C uplink earth station using the maximum transmitter power of 40 dBW, bandwidth of 4 MHz, and a 46 foot antenna as described in the DOD IMT-2000 Assessment at ¶ B.4.2.1.2, with its main beam elevated 3 degrees above the horizon plane, would produce an effective isotropic radiated power (``EIRP'') as high as 58 dBW in the horizon plane. Under unobstructed line of sight (LOS) conditions, an EIRP produces an isotropic receive power, RXI (in dBW), at a point located a distance D from the transmitter, given by RXI = EIRP
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.txt
  • subscribers: Estimated by the FCC. BSP subscribers: NCTA Comments at 8. TABLE B-2 Number and Subscriber Size of Major Cable System Clusters (Cumulative Figures) Range of Clustered Subscribers (thousands) 1994* 1998 2001 2002 Clusters Subscribers (millions) Clusters Subscribers (millions) Clusters Subscribers (millions) Clusters Subscribers (millions) 100-199 58 8.0 33 4.6 30 4.3 31 4.5 200-299 26 6.0 25 6.3 17 4.2 18 4.4 300-399 6 2.0 20 6.7 18 6.1 21 7.1 400-499 3 1.3 7 3.2 10 4.4 10 4.4 >500 4 2.8 21 19.6 32 33.3 29 31.0 Total 97 20.1 106 40.4 107 52.3 109 51.3 Sources: Paul Kagan Associates, Inc., Major Cable TV Systems/Clusters, The Cable TV Financial Databook, 1995, at 38-39; 1999, at 46-48; 2001 from
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-96A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-96A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-96A1.txt
  • although the instant further notice of proposed rulemaking specifically addresses only incumbent LEC PIC-change charges, the proceeding may affect competitive LEC PIC-change charges as well. In addition to residential and business end users, incumbent LECs may also impose PIC-change charges on end-user payphone subscribers when they change their presubscribed IXCs. See, e.g., Ameritech Operating Companies Tariff F.C.C. No. 2, Sec. 4.2(C). PIC-change charges imposed on payphone end-user subscribers are included in the scope of this further notice of proposed rulemaking. Annual 1985 Access Tariff Filings, CC Docket No. 86-125, Memorandum Opinion and Order, 2 FCC Rcd 1416, 1445-46, paras. 272-74 (1987) (1987 Access Tariff Order). A carrier may establish that a higher PIC-change charge is warranted by providing the Commission with
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.txt
  • effective competition finding), the monthly cable rate increased by 5.6 percent, from $43.14 to $45.56, for the year ending January 1, 2004. This increase is lower than the increases of 7.9 percent and 7.5 percent, respectively, for the prior year and the 5-year average. The number of channels on basic and expanded basic increased from 67.3 to 70.1 channels, a 4.2 percent increase for the year ending January 1, 2004, which is lower than the 6.3 percent 5-year average. The price per channel increased by 1.2 percent, from 65.7 cents per channel to 66.5 cents per channel, compared with a 5-year average increase of 0.4 percent. Average rate changes for competitive communities. For the competitive group (the communities where effective competition
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-13A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-13A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-13A1.txt
  • markets. OVS. In 1996, Congress established the open video system (OVS) framework, one of four statutorily-recognized options for the provision of video programming services by LECs. BSPs are the only significant holders of OVS certifications or local OVS franchises. Among BSPs, however, those operating under the OVS framework are in the minority. BSPA reports that approximately eight percent of the 4.2 million homes passed by its members, or 336,000 homes, are passed by systems operating with an OVS certification. BSP Overbuilders. RCN Corporation is the nation's largest broadband overbuilder supplying voice, video, and high-speed Internet access services to residential subscribers over its own network in the Boston, New York, Chicago, San Francisco, Los Angeles, Washington, D.C, and Philadelphia and Lehigh Valley,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-199A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-199A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-199A1.txt
  • TOV. It is clear from the plot that most of the variation in receive sensitivity (i.e., minimum signal level at TOV) of the DTV receivers is due to variations in receiver noise figures rather than variations in the CNR required by the demodulator. In fact, based on standard deviations of the parameters, variability in noise figure among the receivers is 4.2 times as high as the variability in required CNR on channel 30, where the noise figure variations are smallest. On channels 10 and 3, respectively, the noise figure shows 7 and 16 times the variability of required CNR. (a) Required CNR (b) Minimum Signal at TOV -1. Relationship between Minimum Signal at TOV and Required CNR -2. Noise Figure on
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.txt
  • Inmarsat terminals with required accessories 4. Equipment Setup and Inmarsat Receiver Overload Tests 4.1. Equipment Setup Connect the equipment as shown in Figure 1, Equipment Setup Block Diagram. Connect the 100W, 30 dB attenuator (and diplexer, if applicable) to the Inmarsat terminal as recommended by the terminal manufacturer. Connect the tunable filter if/as required. Figure 1: Equipment Setup Block Diagram 4.2. Level Calibration The purpose of this step is to gather data on the signal level losses through the test setup so that interference levels at the input to the Inmarsat terminal receiver can be easily calculated. 4.2.1. With the step attenuator on the output of the two-way power combiner set to 0 dB, measure and record the power losses from
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.txt
  • Baltimore, MD [REDACTED] [REDACTED] [REDACTED] [REDACTED] Boston, MA 85.8% 94.4% 10.1% $ 5.1 million 8.5% $ 4.5 million Buffalo, NY 78.7% 95.3% 21.2% $ 5.0 million 17.7% $ 4.3 million Charlotte, NC 57.6% 63.8% 10.7% $ 6.0 million 8.4% $ 5.2 million Chicago, IL [REDACTED] [REDACTED] 0.0% - 0.0% - Cincinnati, OH 61.9% 68.9% 11.4% $ 4.9 million 9.1% $ 4.2 million Cleveland, OH 44.2% 77.8% 75.9% $ 32.3 million 56.3% $ 28.0 million Columbus, OH 50.1% 58.4% 16.5% $ 6.9 million 12.6% $ 6.0 million Dallas, TX 49.2% 53.8% 9.4% $ 11.7 million 7.2% $ 10.1 million Denver, CO [REDACTED] [REDACTED] 0.0% - 0.0% - Detroit, MI [REDACTED] [REDACTED] 0.0% - 0.0% - Green Bay, WI 60.4% 60.4% 0.0% -
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-11A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-11A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-11A1.txt
  • BSPA Comments at 6 for the 2004 Report and Commission estimates; 2005 subscribers from Commission estimates. TABLE B-2 Number and Subscriber Size of Major Cable System Clusters (Cumulative Figures) Range of Clustered Subscribers (thousands) 2001 2002 2003 2004 Clusters Subscribers (millions) Clusters Subscribers (millions) Clusters Subscribers((millions) Clusters Subscribers((million s) 100-199 30 4.3 31 4.5 34 4.9 46 5.4 200-299 17 4.2 18 4.4 18 4.4 18 6.3 300-399 18 6.1 21 7.1 17 5.7 17 6.6 400-499 10 4.4 10 4.4 10 4.4 8 3.5 >500 32 33.3 29 31.0 29 34.3 29 29.7 Total 107 52.3 109 51.3 108 53.6 118 51.5 Sources: 2001 from Kagan World Media, Major Cable TV Systems/Clusters, Broadband Cable Financial Databook 2002 at 38; 2002
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-120A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-120A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-120A1.txt
  • Plans. The specific procedures governing Plan modifications are set forth in Appendices 30 and 30A of the ITU Radio Regulations. These procedures also apply to satellites operating at locations in the ITU Region 2 Plan, but with parameters different from those contained in the Plan. In that case, the country proposing the non-conforming satellite must request a Plan modification. Section 4.2 of Article 4 of Appendices 30 and 30A of the ITU Radio Regulations stipulates the modification procedures for the Region 2 Plans. Administrations start the process by filing the information required by Appendix 4 of the Radio Regulations. For U.S. Plan modifications, the Appendix 4 information is prepared by the satellite operators and submitted to the Commission, which reviews the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-150A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-150A2.txt
  • 670 907 74510 341250 1180340 31637 15069 0 35855CASACRAMENTO 6 9 19.2 567 74604 381618 1213018 33919 5291 13.9 25048CASACRAMENTO 10 10 16.6 595 74695 381424 1213003 37093 6313 0 51499CASACRAMENTO 31 21 850 581 381554 1212924 39963 6384 0 33875CASACRAMENTO 3 351000 591 74812 381552 1212922 37892 5069 17.4 10205CASACRAMENTO 40 40 765 581 70334 381618 1213018 31502 4587 4.2 52953CASACRAMENTO 29 481000 489 44981 381554 1212924 30324 4218 1.1 19653CASALINAS 8 8 19.2 736 70343 364523 1213005 28847 2561 14.8 14867CASALINAS 35 13 19.8 720 44925 364522 1213006 23793 1122 49.2 58795CASAN BERNARDINO 24 26 440 529 335757 1171705 20478 13150 0 58978CASAN BERNARDINO 30 381000 909 46152 341246 1180341 23334 14423 0 42122CASAN DIEGO 8 8 5.42 208
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.txt
  • General Counsel of the FBI, and the Deputy Attorney General, Criminal Division, DOJ, and the General Counsel of DHS or their designees, unless the FBI, DOJ, or DHS believes that important national interests can be protected, or a Domestic Communications Company believes that its paramount commercial interests can be resolved, only by resorting to the measures set forth in Section 4.2 of this Agreement. If, after meeting with higher authorized officials, any of the Parties determines that further negotiation would be fruitless, then that Party may resort to the remedies set forth in Section 4.2 of this Agreement. If resolution of a disagreement requires access to Classified Information, the Parties shall designate a person or persons possessing the appropriate security clearances
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-47A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-47A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-47A1.txt
  • applies. Because the required information bears on each applicant's qualifications, confidentiality requests will not be routinely granted. Applicants may make multiple changes to their FCC Form 175 applications until the close of the filing window. However, applicants must press the SUBMIT button in the FCC Auction System for the changes to be submitted and considered by the Commission. Software Requirements .4.2_05. (choose the JRE version). Other browsers are not supported. ) Currently, the Apple(R) Mac OS(R) is not supported. Logging On (secondary location). Once on the FCC Integrated Spectrum Auction System page, an applicant may log in to create an FCC Form 175 application using its FCC Registration Number (FRN) and password. Application Filing Instructions The on-line FCC Form 175 requests
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A1.txt
  • nation's broadcast licenses were given away decades ago when women and people of color were unlikely to obtain them. Those sins of omission need to be excised and new strategies to encourage diversity in ownership and jobs and programming need to be put in place. While people of color make up over 30 percent of our population, they own only 4.2 percent of the nation's radio stations and 1.5 percent of the nation's TV stations! More recent statistics suggest that even these numbers are in free fall. I believe the ownership of our media should look more like the diversity of our people. But if all the Commission does is ask a few pat questions and then sweep this issue under
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A3.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-93A3.txt
  • nation's broadcast licenses were given away decades ago when women and people of color were unlikely to obtain them. Those sins of omission need to be excised and new strategies to encourage diversity in ownership and jobs and programming need to be put in place. While people of color make up over 30 percent of our population, they own only 4.2 percent of the nation's radio stations and 1.5 percent of the nation's TV stations! More recent statistics suggest that even these numbers are in free fall. I believe the ownership of our media should look more like the diversity of our people. But if all the Commission does is ask a few pat questions and then sweep this issue under
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.txt
  • Device: Intentional radiators operating in the frequency bands in the 5150-5350 MHz and 5470-5825 MHz that use wideband digital modulation techniques and provide a wide array of high data rate mobile and fixed communications for individuals, businesses, and institutions. U-NII Detection Bandwidth: The contiguous frequency spectrum over which a U-NII device detects a Radar Waveform above the DFS Detection Threshold. 4.2 Symbols For the purposes of this document, the following symbols apply: ATT Attenuator B Number of Bins Burst_Count The number of Bursts within a single 12 second Long Pulse radar (waveform 5) Chr Channel occupied by a radar D Distance Dwell Dwell time per bin G Antenna gain (dBi) N Number of spectrum analyzer bins showing a U-NII transmission FH
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-138A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-138A2.txt
  • 670 907 74510 341250 1180340 31637 15069 0 35855CASACRAMENTO 6 9 19.2 567 74604 381618 1213018 33919 5291 13.9 25048CASACRAMENTO 10 10 16.6 595 74695 381424 1213003 37093 6313 0 51499CASACRAMENTO 31 21 850 581 381554 1212924 39963 6384 0 33875CASACRAMENTO 3 351000 591 74812 381554 1212924 37884 5024 17.7 10205CASACRAMENTO 40 40 765 581 70334 381618 1213018 31502 4587 4.2 52953CASACRAMENTO 29 481000 489 44981 381554 1212924 30324 4218 1.1 19653CASALINAS 8 8 19.2 736 70343 364523 1213005 28847 2561 14.8 14867CASALINAS 35 13 19.8 720 44925 364522 1213006 23793 1122 49.2 58795CASAN BERNARDINO 24 26 440 529 335757 1171705 20478 13150 0 58978CASAN BERNARDINO 30 381000 909 46152 341246 1180341 23330 14414 0.1 42122CASAN DIEGO 8 8 14.9 226
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-170A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-170A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-170A1.txt
  • adding channels and never running out of capacity. Moreover, because digital cable systems offer so much more capacity, the proportion of overall bandwidth devoted to must-carry signals is that much smaller than was the case at the time of the Turner decisions. For example, NAB and MSTV explain that 18 basic analog channels, which includes all must-carry stations, represent about 4.2 percent of the total number of channels and about 6.8 percent of the total downstream spectrum of a typical cable system today. In 1993, by contrast, the same number of channels represented 33 percent of the capacity of a ``high capacity'' cable system. We believe that the typical cable operator electing to down-convert digital signals will devote significantly less than
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-17A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-17A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-17A1.txt
  • connections in service, as reported on FCC Form 477, has increased rapidly, from 380,000 in June 2005, to 3.1 million in December 2005, and to 11 million in June 2006. Interconnected VoIP subscribership in the United States also appears to have grown rapidly since the 2004 Data Collection Order was adopted, reportedly increasing from 1.2 million subscribers in 2004 to 4.2 million subscribers at the end of 2005, and to over 8 million subscribers by September 2006. In a separate proceeding, we have explained that the growth of interconnected VoIP services is one of the changing market conditions that are placing under significant strain the existing system to preserve and advance universal service, which is a fundamental goal of communications policy
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-186A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-186A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-186A1.txt
  • in the projected use of VRS in 2006 and 2007. See 2006 Bureau TRS Rate Order, 21 FCC Rcd at 7022, para. 11 (citing 2006 NECA Filing at Ex. 1D). In fact, the use of VRS has continued to rapidly rise in the 2006-2007 Fund year: from 3.2 million minutes in January, to 3.6 million minutes in July, to over 4.2 million minutes in December, and to nearly 5.3 million minutes in May 2007. See 2007 NECA Filing; www.neca.org (Resources, then TRS) (monthly reports of minutes of use). See 2006 TRS Cost Recovery FNPRM, 21 FCC Rcd at 8391, para. 27. The Commission also noted that since 2004 the Commission has adopted VRS speed of answer and interoperability requirements, which may
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-192A1.txt
  • three sets of radio frequency bands: the 2 GHz MSS band (the 1990-2025 MHz uplink and the 2165-2200 MHz downlink), the L-band (general designation for frequencies from 1 to 2 GHz) and the Big LEO bands (referring to the 1.6/2.4 GHz bands). See Staff Report at ¶ 76. See supra ¶ 11and note 31. ANSI C63.19-2007 Standard at 18, Table 4.2. 700 MHz Service Report and Order, 22 FCC Rcd at 8119 ¶ 148. See Hearing Aid Compatibility Order, 18 FCC Rcd at 16779 ¶ 63 (not discussing the inclusion of additional services, air interfaces, or frequency bands). The Chief, Wireless Telecommunications Bureau, in coordination with Chief, Office of Engineering and Technology, does have delegated authority to approve revised versions of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.txt
  • rolling out more news and talk stations and are otherwise providing substantial service to their local listeners; thus, NAB concludes that common ownership provides affirmative benefits to the public by increasing listening choices and enhancing local service. Based on our examination of the record, the evidence does not show that consolidation in local markets has harmed localism. Media Ownership Study 4.2 finds that the existence of economies of scope in production and distribution is supported by the findings that stations owned by parents that have more pervasive radio operations are more likely to air informational programming. The Study also provides some evidence that stations with nearby owners air more news and more local news. We also note that the parties who
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-33A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-33A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-33A1.txt
  • states that under the 1992 Mexico-United States FM Broadcasting Agreement, domestic U.S. assignments or allotments within 320 kilometers (199 miles) of the common border must be separated from Mexican assignments or allotments by not less than the distances stated in the rule. See 47 C.F.R. § 73.207. iBiquity Comments at 39. See Barry McLarnon Reply Comments at 3-4. See Section 4.2 of the Agreement Between the Government of the United States of America and the Government of Canada Relating to the AM Broadcasting Service in the Medium Frequency Band, 1984. See Barry McLarnon Comments at 3. According to McLarnon, the hybrid IBOC AM system creates two new ``stations'' in the first adjacent channels, each with a total power of -16 dBc.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-43A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-43A1.txt
  • national interests can be protected, or the Companies believe that their paramount commercial interests can be resolved, only by resorting to the measures set forth in this Agreement. If, after meeting with higher authorized officials, any of the Parties determines that further negotiation would be fruitless, then that Party may resort to the remedies set forth in this Agreement. 18 4.2. Enforcement of Agreement. If any of the Parties believes that any other of the Parties has breached or is about to breach this Agreement, that Party may bring an action against the other Party for appropriate injunctive or other judicial relief. Nothing in this Agreement shall limit or affect the right of any Party to exercise any rights it may
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-72A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-72A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-72A1.txt
  • to 2.5 GHz frequency bands. Future versions may add tests for other frequency bands, as they come into more common use. ``American National Standard Methods of Measurement of Compatibility between Wireless Communications Devices and Hearing Aids,'' ANSI C63.19-2006, Accredited Standards Committee on Electromagnetic Compatibility, C63, approved Apr. 6, 2006 (ANSI C63.19-2006 Standard), at 1. See ANSI C63.19-2006 Standard at Table 4.2 (listing target values for validation procedures using dipoles at a limited number of frequencies, and excluding AWS-1 frequencies), Table 7.1 (giving Articulation Weighting Factors for CDMA, TDMA (50 Hz), GSM, UMTS (WCDMA) and TDMA (22 Hz and 11 Hz)). See also Comments from American National Standards institute Accredited Standards Committee C63 (EMC) ANSI ASC C63, WT Docket Nos. 01-309, 06-203,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-72A1_Erratum.doc
  • to 2.5 GHz frequency bands. Future versions may add tests for other frequency bands, as they come into more common use. ``American National Standard Methods of Measurement of Compatibility between Wireless Communications Devices and Hearing Aids,'' ANSI C63.19-2006, Accredited Standards Committee on Electromagnetic Compatibility, C63, approved Apr. 6, 2006 (ANSI C63.19-2006 Standard), at 1. See ANSI C63.19-2006 Standard at Table 4.2 (listing target values for validation procedures using dipoles at a limited number of frequencies, and excluding AWS-1 frequencies), Table 7.1 (giving Articulation Weighting Factors for CDMA, TDMA (50 Hz), GSM, UMTS (WCDMA) and TDMA (22 Hz and 11 Hz)). See also Comments from American National Standards institute Accredited Standards Committee C63 (EMC) ANSI ASC C63, WT Docket Nos. 01-309, 06-203,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.txt
  • mispointing of their own BSS receiving antennas. See 17/24 GHz BSS NPRM, 21 FCC Rcd at 7449, para.48. Id. Id. See 47 C.F.R. §§ 25.211(d), 25.212 (c)-(d). Id. See 47 C.F.R. § 25.209. See 17/24 GHz BSS NPRM at 7450, para. 49. See 17/24 GHz BSS NPRM at 7451, para. 50. Id. See DIRECTV Comments at 14-15, EchoStar Comments at A.4.2, SES Americom Comments at 16. See Intelsat Comments at 11. See Intelsat Reply Comments at 12-13. See 47 C.F.R. § 25.138(a)(1)-(4). See DIRECTV Comments at 14-15, EchoStar Reply Comments at 15 and Exhibit 1, 8-11, SES Americom Reply Comments at 20, Intelsat Reply Comments at 12-13. See SES Americom Reply Comments at 20. See DIRECTV Comments at 15, EchoStar Comments
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-99A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-99A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-99A1.txt
  • of 45 degrees only if the 3650 MHz transmitter is at least 600 meters away. According to SIA's calculations, a sufficient C/I ratio will never be achieved if the transmitter is 1000 meters away and the arrival angle of the 3650 MHz signal is 15 degrees or less. See Theodore S. Rappaport, Wireless Communications Principles & Practice 138-39, & Tab. 4.2 (2d ed. 2002) (proper path loss exponent for exterior environments is between 2.7 and 5); Propagation of Radio Waves 191-192 (Les Barclay, ed., 2d ed. 2003). The acceptable range for C/I margin under the different conditions of separation distance and satellite arrival angle is shown in Attachment B to SIA's petition for reconsideration. It's C/I margin calculations there still indicate
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.txt
  • name for the Internet resource translation mechanism. Various capabilities built on DNS, e.g., delegation, Telephone Number Mapping (ENUM), and Dynamic DNS (DDNS), provide a range of methods to support relay interoperability. DDNS is an existing DNS capability used to link domain names to IP addresses when those addresses are dynamically rather than statically assigned. See ATIS Report at 17, para. 4.2.2.1. One additional, and unique, aspect of the CSDVRS ONS plan is its proposal to have a neutral third party establish a full ``ONS VoIP Network'' to ``support the termination of . . . calls at the designated relay provider.'' See CSDVRS Refresh Comments at 14. See Letter from Toni R. Acton, Director, AT&T Services Inc., to Marlene H. Dortch, Secretary,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-173A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-173A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-173A1.txt
  • schools and libraries to effectuate meaningful communications among parents, teachers, and school and library administrators. Further, as the Commission also noted in the 2006 Interim Contribution Methodology Order, the use of and revenue from interconnected VoIP services has grown dramatically in recent years. The number of interconnected VoIP service subscribers grew from about 150,000 at the end of 2003 to 4.2 million at the end of 2005. Thus, we believe that schools and libraries could benefit from the same cost efficiencies and service features that have led many consumers to choose this technology. Moreover, because interconnected VoIP components are eligible under the E-rate program as Internal Connections components, schools and libraries might realize cost savings in using interconnected VoIP both for
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-233A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-233A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-233A1.txt
  • two years of outage reports. MSNBC argues that OET failed to justify the invocation of FOIA Exemption 4, and also failed ``to engage in the type of case-specific analysis that the rulemaking relied on said was necessary.'' Subsequently, the Commission received 16 new FOIA requests for NORS outage reports. The Public Safety and Homeland Security Bureau (PSHSB) recognized that section 4.2 of the Commission's rules requires that notice of the FOIA requests for the outage reports be provided to all entities that had filed reports subject to the FOIA requests. PSHSB therefore notified all filers of outage reports for the past two years of MSNBC's FOIA AFR and 15 of the new FOIA requests. Thirty-seven responses were received opposing the release
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.txt
  • to be wireless only, with over half of U.S. adults who only use a cellphone being under 30 (compared to 22 percent of U.S. adults in that age group). In the last half of 2006, according to the NHIS survey, 12.8 percent of households (as opposed to adults) were wireless-only, up from 8.4 percent at the end of 2005, and 4.2 percent at the end of 2003. Among the 20 largest U.S. cities, Detroit and Minneapolis-St. Paul have the highest rates of wireless substitution by households, at 19 percent and 15.2 percent, respectively. Tampa, FL came in a close third with 15.1 percent. Other cities where people have been replacing their landlines with wireless at rates greater than 10 percent include
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-72A2.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-72A2.txt
  • 31637 15069 0 35855CA SACRAMENTO 6 9 19.2 567 74604 381618 1213018 34662 5980 2.7 25048CA SACRAMENTO 10 10 22.3 595 84845 381424 1213003 38949 6597 0 51499CA SACRAMENTO 31 21 850 581 381554 1212924 39963 6384 0 33875CA SACRAMENTO 3 351000 591 74812 381554 1212924 37884 5024 17.7 10205CA SACRAMENTO 40 40 765 581 70334 381618 1213018 31502 4587 4.2 52953CA SACRAMENTO 29 481000 489 44981 381554 1212924 30324 4218 1.1 19653CA SALINAS 8 8 19.2 736 70343 364523 1213005 28304 2557 14.9 14867CA SALINAS 35 13 19.8 720 44925 364522 1213006 23793 1122 49.2 58795CA SAN BERNARDINO 24 26 475 510 335757 1171705 20569 13293 0 58978CA SAN BERNARDINO 30 381000 909 46152 341246 1180341 23330 14414 0.1 42122CA
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-20A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-20A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-20A1.txt
  • in MHz. See AMF petition at 17. See 47 C.F.R. 95.635(d). These limits generally reflect the same field strength limits presently specified in Section 95.635 (d)(1) for the MICS See §2.1093 (c). The limits to be used for evaluation are based generally on criteria published by the American National Standards Institute (ANSI) for localized specific absorption rate (``SAR'') in Section 4.2 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992, Copyright 1992 by the Institute of Electrical and Electronics Engineers, Inc., New York, New York 10017. See §2.1093 (d). Proposed Changes in the Commission's Rules Regarding Human Exposure to Radiofrequency Electromagnetic Fields, ET Docket No. 03-137, Notice
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-43A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-43A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-43A1.txt
  • ¶¶ 275-281 (2003), aff'd in part and remanded in part, Prometheus, 373 F.3d at 435, stay modified on rehearing, No. 03-3388 (3d Cir. Sept. 3, 2004), cert. denied, 545 U.S. 1123 (2005). Id. at 13729-30 ¶¶ 282-86. See 47 C.F.R. § 73.3555(a), (c). Telecommunications Act of 1996, Pub. L. No. 104-104, 110 Stat. 56 (1996), Section 202 (h). See Study 4.2: "Ownership Structure, Market Characteristics and the Quantity of News and Public Affairs Programming: An Empirical Analysis of Radio Airplay" by Kenneth Lynch; Study 5: "Station Ownership and programming in Radio" by Tasneem Chipty; Study 10: "Review of the Radio Industry, 2007" by George Williams. These studies are posted at www.fcc.gov/ownership/studies.html. PPMC Reply Comments at 3-4. PPMC adds that if the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-57A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-57A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-57A1.txt
  • the height of the tip of the antenna would exceed three (3) meters (9.8 feet) above ground. In any event, no antenna may be configured for permanent outdoor use. See §2.1093 (c). The limits to be used for evaluation are based generally on criteria published by the American National Standards Institute (ANSI) for localized specific absorption rate (``SAR'') in Section 4.2 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992, Copyright 1992 by the Institute of Electrical and Electronics Engineers, Inc., New York, New York 10017. See §2.1093 (d). Proposed Changes in the Commission's Rules Regarding Human Exposure to Radiofrequency Electromagnetic Fields, ET Docket No. 03-137, Notice
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.txt
  • probability of interference. If, in this example, the FSS operator raised PFD levels to compensate for the first 12 dB of rain fade, some FS links would experience an increase in PFD - and therefore an increased likelihood of interference - from FSS as much as ten percent of the time. If, on the other hand, the FSS operator employed 4.2 dB of non-power ameliorative measures to overcome rain fade prior to increasing PFD, our analysis indicates that this would reduce the exposure of the FS link to an increase in PFD above the clear-air values from ten percent down to a maximum of one and one-half percent of the time. These non-power ameliorative measures would also reduce the exposure of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1_Rcd.pdf
  • would experience an increased probability of interference.82If, in this example, the FSS operator raised PFD levels to compensate for the first 12 dB of rain fade, some FS links would experience an increase in PFD ­and therefore an increased likelihood of interference ­from FSS as much as ten percent of the time.83If, on the other hand, the FSS operator employed 4.2 dB of non-power ameliorative measures to overcome rain fade prior to increasing PFD, our analysis indicates that this would reduce the exposure of the FS link to an increase in PFD above the clear-air values fromten percent down to a maximum of one and one-half percent of the time. These non- power ameliorative measures would also reduce the exposure of
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-63A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-63A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-63A1.txt
  • comment on how to ensure that a certification authority can be limited to a workable size without having the unintended result of arbitrarily restricting the participation of interests that should be involved in the authority's activities. We also seek comment on the applicability to the certification authority of the membership criteria set out in International Standard ISO/IEC 17011(E), particularly sections 4.2 (Structure) and 4.3 (Impartiality). Assuming a certification authority possessed the significant degree of autonomy on which we seek comment, would it be necessary for the Commission to prescribe other rules regarding membership, such as procedures for admitting new members or time limits on the service of particular entities and individuals? Operating Procedures: Having charge, as it would, of the centerpiece
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.txt
  • the operating system that supports them. The application stores are specific to particular operating systems, and, in many cases, the application stores may be available only on devices running a certain, more recent version of an operating system or on devices with certain hardware features. For instance, the Blackberry App World is available on Blackberry smartphones running BlackBerry Device Software v4.2 or higher with a trackball, trackpad, or touch screen. Mobile data application usage varies among iPhone users, smartphone users, and average mobile wireless subscribers, with iPhone user adoption rates leading average smartphone user adoption rates in every category. The most popular paid applications downloaded from the Apple App store are games, while the most popular free applications are social networking
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1_Rcd.pdf
  • the United States and Puerto Rico. 98Commissionestimates are based on American Roamer database, Nov. 2009. The estimates include coverage by all EVDO, EVDO Rev. A, HSPA/UMTS/WCDMA, and mobile WiMAX networks. Population and land area are based on census blocks. POPs are from the 2000 Census, and square miles include the United States and Puerto Rico. 99Equivalently, 12 million people, or 4.2 percent of the U.S. population, are not served by three or more mobile service providers. 100Equivalently, 26 million people, or 9.2 percent of the U.S. population, are not served by four or more mobile service providers. 11450 Federal Communications Commission FCC 10-81 percent of the U.S. population, are served by one or more mobile broadband providers. The percentage of the
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.txt
  • 350,305 81% 4179 * 18.5 60 Appleton-Oshkosh-Neenah, WI 370,326 461,535 80% 2545 2618 143.6 165 Redding, CA-OR 290,625 362,225 80% 3036 2888 14.4 47 Lexington, KY-TN-VA-WV 1,538,900 1,943,408 79% 3406 3869 80.4 54 Erie, PA 403,388 509,887 79% 4196 4241 116.4 58 Northern Michigan, MI 206,918 265,214 78% 4229 * 28.5 145 Great Falls, MT 127,452 163,968 78% 5104 8303 4.2 162 Fresno, CA 1,279,408 1,642,331 78% 2926 2962 98.6 76 Greenville, MS 170,285 222,248 77% 3941 3575 41.0 92 Fayetteville-Springdale-Rogers, AR-MO-OK 404,378 527,035 77% 4654 4729 88.4 114 Aberdeen, SD 59,321 77,157 77% 4914 * 5.4 168 Pendleton, OR-WA 153,760 205,791 75% 3068 2894 8.7 4 Burlington, VT-NY 450,191 619,614 73% 5443 8263 57.6 105 La Crosse, WI-MN 185,357 253,647
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1_Rcd.pdf
  • 350,305 81% 4179 * 18.5 60 Appleton-Oshkosh-Neenah, WI 370,326 461,535 80% 2545 2618 143.6 165 Redding, CA-OR 290,625 362,225 80% 3036 2888 14.4 47 Lexington, KY-TN-VA-WV 1,538,900 1,943,408 79% 3406 3869 80.4 54 Erie, PA 403,388 509,887 79% 4196 4241 116.4 58 Northern Michigan, MI 206,918 265,214 78% 4229 * 28.5 145 Great Falls, MT 127,452 163,968 78% 5104 8303 4.2 162 Fresno, CA 1,279,408 1,642,331 78% 2926 2962 98.6 76 Greenville, MS 170,285 222,248 77% 3941 3575 41.0 92 Fayetteville-Springdale-Rogers, AR-MO-OK 404,378 527,035 77% 4654 4729 88.4 114 Aberdeen, SD 59,321 77,157 77% 4914 * 5.4 168 Pendleton, OR-WA 153,760 205,791 75% 3068 2894 8.7 4 Burlington, VT-NY 450,191 619,614 73% 5443 8263 57.6 105 LaCrosse, WI-MN 185,357 253,647 73%
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-107A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-107A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-107A1.txt
  • 8 million paying users worldwide for its SkypeIn and SkypeOut services and had domestic revenues of over $100 million in 2009. A number of companies, such as Skype and Google Voice offer a variety of ``one-way'' interconnected VoIP services that enable inbound calls from the PSTN or outbound calls to the PSTN, but not both. There are now well over 4.2 million subscribers to one-way interconnected VoIP services, which was the number of two-way interconnected VoIP subscribers in 2005 when the FCC adopted the original interconnected VoIP 911 rules. Moreover, since 2005, a number of hardware products have been introduced that support outbound-only interconnected VoIP service and are indistinguishable from traditional landline or cordless phones in their ability to place outbound
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-14A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-14A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-14A1.txt
  • broadband to advance national purposes such as education, health care, energy, and public safety. The resulting National Broadband Plan, published on March 16, 2010, noted the necessity for ``continuous collection and analysis of detailed data on competitive behavior,'' and stressed the need for the Commission to conduct ``more thorough data collection to monitor and benchmark competitive behavior.'' In particular, recommendation 4.2 of the Plan suggested that the Commission ``revise Form 477 to collect data relevant to broadband availability, adoption and competition.'' NTIA's Broadband Inventory Map In order to comply with requirements under the BDIA and the ARRA, NTIA in July 2009 established a State Broadband Data and Development Grant Program (SBDD). Through this program, NTIA has awarded grants, funded through 2015,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-160A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-160A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-160A1.txt
  • RFC/FNPRM, when we reviewed the issue anew therein, it was entirely appropriate to consider the information from these two studies in explaining our tentative conclusion in reviewing this matter that the 40 dB/decade standard should be retained. ARRL reply comments at 19-20. CURRENT comments at 6. HomePlug comments at 7. See Figure 4-2 in NTIA Phase 2 Study, at section 4.2.2. , supra. See NTIA Phase 2 Study at Section 2.3.2. Exhibit B to ARRL comments at 2. ARRL comments at 48, IBEC comments at 2. ARRL comments at 49. ARRL does not specifically identify these studies. ARRL comments at 52-54. ARRL also points out that few if any HF antennas are located at the 1 meter height at which test
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.txt
  • For apportionment among the operations, the cost of circuit equipment is assigned to the following subsidiary categories: (1) Exchange Circuit Equipment - Category 4.1. (i) Wideband Exchange Line Circuit Equipment - Category 4.11. (ii) Exchange Trunk Circuit Equipment (Wideband and Non-Wideband) - Category 4.12. (iii) Exchange Line Circuit Equipment Excluding Wideband - Category 4.13. (2) Interexchange Circuit Equipment - Category 4.2. (i) Interexchange Circuit Equipment Furnished to Another Company for Interstate Use - Category 4.21. (ii) Interexchange Circuit Equipment Used for Wideband Services including Satellite and Earth Station Equipment used for Wideband Service - Category 4.22. (iii) All Other Interexchange Circuit Equipment - Category 4.23. (3) Host/Remote Message Circuit Equipment - Category 4.3 (4) Middle Mile Circuit Equipment - Category 4.4
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-6A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-6A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-6A1.txt
  • Information Technology Advisory Commission Comments on Competition Public Notice at 1 (Sept. 13, 2010). APCO Project 25 Steering Committee Comments on Competition Public Notice at 10-11 (Sept. 20, 2010). See supra Section III.A. See id. See, e.g., 3rd Generation Partnership Project; Technical Specification Group Services and System Aspects; Network Sharing; Architecture and functional description (Release 9), 3GPP TS 23.251 at 4.2.1 (2009). See Public Safety and Homeland Security Bureau Seeks Comment on Interoperability, Out of Band Emissions and Equipment Certification for 700 MHz Public Safety Broadband Networks, PS Docket 06-229, Public Notice, 25 FCC Rcd 5486 (PSHSB 2010) (Technical Public Notice). See NPSTC BBTF Report at 6.3.1. See id. See Technical Public Notice at 5487-88. For example, if there are 55
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.txt
  • would be subject to the reporting requirements and process adopted therein were collecting much of the same information that would be required to be reported under Part 4. See 2004 Part 4 Order and NPRM, 19 FCC Rcd at 16912-3 ¶ 166-69; see also 1992 Part 4 Report and Order, 7 FCC Rcd at 2013 ¶17 (1992). 47 C.F.R. § 4.2 provides that ``[r]eports filed under this part will be presumed to be confidential. Public access to reports filed under this part may be sought only pursuant to the procedures set forth in 47 CFR § 0.461.'' See also 2004 Part 4 Report and Order, 19 FCC Rcd at 16856. See 47 C.F.R. § 0.442. See also 47 U.S.C. § 154(i)
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.txt
  • outage reporting information to the public could present an unacceptable risk of more effective terrorist activity,'' and that the record on outage reporting has clearly established that reports should be protected by the Freedom of Information Act. Also, TIA believes that the record reflects wide consensus for maintaining confidentiality for data submitted through the NORS system. Discussion. Consistent with Section 4.2 of the Rules that affords a presumption of confidentiality to outage report filed pursuant to Part 4 of the Rules, we direct that individual outage reports of interconnected VoIP service providers also be treated on a presumptively confidential basis, that sharing of such reports with other Federal agencies, as needed, be conducted on the same basis, and that aggregated information
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-46A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-46A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-46A1.txt
  • was appropriate to assess such services as an exercise of permissive authority. The Commission determined that an immediate extension of contribution obligations to interconnected VoIP service was warranted due to the growth in demand for the Fund, the decline in the contribution base overall, and the ``robust growth in subscribership'' to interconnected VoIP services, from 150,000 subscribers in 2003 to 4.2 million subscribers in 2005. We seek comment on continuing this general approach of addressing the contribution obligations of specific services on a service-by-service basis. First, we seek comment on exercising permissive authority with respect to certain services for which contribution obligations are currently subject to dispute. To the extent commenters believe that any such services should be non-assessable, we also
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.txt
  • (e) * * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.2 Interexchange Circuit Equipment to the jurisdictions shall be updated annually. (f) * * * (2) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the subcategory specified in § 36.126(f)(1) among the jurisdictions using the allocation factor, as specified in § 36.126(f)(1)(i), for this subcategory for the twelve month period ending December 31, 2000.
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-68A3.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-68A3.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-68A3.txt
  • [33] The NPSBN SHALL support the usage of all 15 ARP values defined in 3GPP 23.203. [34] The NPSBN SHALL support the ARP pre-emption capability and vulnerability functions as defined in 3GPP 23.203. [35] The NPSBN SHALL implement a nationwide scheme for assigning Access Classes to public safety users and secondary users following the 3GPP recommendations in TS 22.011, Section 4.2. [36] The NPSBN SHALL implement a nationwide scheme for assigning QoS Class Identifier priority to IP network and backhaul priority across the entire NPSBN. [37] The NPSBN SHALL support the use of industry standard VPN and MVPN technology, while providing priority and Quality of Service for encapsulated applications. Security [38] The NPSBN SHALL use a nationwide common security profile for
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-96-209A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-96-209A1.txt
  • AT&T traffic volume. BT argues that AT&T's resources also give dominant foreign carriers reason to discriminate in favor of AT&T through arrangements such 130 Consolidated Application of AT&T and Specified Bell System Companies, 96 FCC 2d 18 (1984) ('Consolidated Application"). 131 Id. at 62. 132 France Telecom and Deutsche Telekom, for example, have made a commitment to invest $3.5 - 4.2 billion in the Sprint Corporation. See Petition for Declaratory Ruling Concerning Section 310(bX4) and (d) and the Public Interest Requirements of the Communications Act of 1934, as amended, FCC 95-498 (released Jan. 11, 1996). In addition, British Telecom has made a $4.3 billion investment in MCI. See MCI Communications Corporation, 9 FCC Red 3960 (1994). 133 Statistics of Common Carriers,
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.txt
  • stations in the broadcasting-satellite service). See ITU's Circular Letter C/58, dated October 21, 1996 (Circular Letter C/58). When attempting to modify the Plans, an Administration must submit to the ITU the names of administrations who are affected by the proposed modification, or state that the limits in Annex 1 are not exceeded. See Section 4.3.5.1 of Appendix S30 and Section 4.2.6.1 of Appendix S30A. See Circular Letter C/58. ITU Radio Regulations, Appendices S30 and S30A contain provisions for "modifying" the Plans in order to include systems in the Plan that use different technical parameters. The Commission has submitted these technical modifications of the Plans to the ITU Radiocommunication Bureau in accordance with Article 4 of Appendices S30 and S30A. E.g., for
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.pdf http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.txt
  • to the measures set forth in section 4.3.1 below. If, after meeting with higher authorized officials, either party determines that further negotiation would be fruitless, then either party may resort to the remedies set forth in Section 4.3.1 below. If resolution of a disagreement requires access to Classified Information, the designees of all Parties shall possess the appropriate security clearances. 4.2 Denial of Access to Information Nothing contained in this Agreement shall limit or affect the authority of the head of a United States Government agency to deny, limit or revoke the Company's access to Classified, Controlled Unclassified, and Sensitive Information under its jurisdiction. 4.3 Enforcement of Agreement 4.3.1. Remedies for Breach. Subject to section 4.1 of this Agreement, if any
• http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-344A1.doc http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-344A1.pdf
  • made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and to protect the DoJ's and the FBI's interests. 4.2 Inspections. Upon reasonable notice and during reasonable hours, the DoJ and the FBI may visit any telecommunications facility of TMI in the United States, and may inspect any part of said TMI facility for the purpose of verifying compliance with the terms of this Agreement and the Implementation Plan. 4.3 Interviews. Upon reasonable notice from the DoJ or the FBI,
• http://licensing.fcc.gov/prod/callsign/manuser.html
  • [25]Form 159. Also, an Adobe Acrobat version of the form and instructions can be found at [26]159.pdf. 4. Data Entry Problems (FRN, Red Light Warning) 4.1 FRN Entry The FRN - a 10 digit field, is to be entered without dashes. You will need to enter any preceding zeros. The FRN is a required field for all call sign requests. 4.2 Red Light Warning You or an entity sharing the same Taxpayer Identification Number are delinquent on debts owed to the FCC. You can continue with requesting your call sign, however, until the delinquent debt is resolved, there will not be any action taken on the call sign request or any other application requests for agency authorizations. 5. Possible Error Codes
• http://transition.fcc.gov/Bureaus/Cable/Reports/fcc98335.pdf http://transition.fcc.gov/Bureaus/Cable/Reports/fcc98335.txt
  • Independent Film Channel Sep-94 Cablevision (75) International Channel Jul-90 TCI (90) Kaleidoscope Sep-90 TCI (12) Knowledge TV (formerly Mind Extension University) Nov-87 Jones (97) MoreMAX (formerly Cinemax2) Aug-91 Time Warner (100) MuchMusic USA Jul-94 Cablevision (75) Odyssey Channel Oct-93 TCI (32.5) Outdoor Life Network Jul-95 Cox (33.3), TCI (16.7), Comcast (8.3), MediaOne (8.3) Ovation: The Arts Network Apr-96 Time Warner (4.2) Prevue Channel Jan-88 TCI (44) PIN (Product Information Network) Apr-94 Cox (45) QVC Nov-86 Comcast (57), TCI (43) Romance Classics Jan-97 Cablevision (75) Sci-Fi Channel Sept-92 TCI (18.6), MediaOne (<1) Sneak Prevue May-91 TCI (12) Speedvision Dec-95 Cox (33.3), TCI (16.7), Comcast (8.3), MediaOne (8.3) Federal Communications Commission FCC 98-335 D-4 Programming Service Launch Date MSO Ownership (%) Starz! Feb-94
• http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.txt http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.wp
  • assign initial codes to the extent required to terminate traffic.85 To obtain an initial code, the applicant must certify that a need exists due to routing, billing, regulatory or tariff requirements.86 Although applicants may be Federal Communications Commission FCC 99-122 __________________________________________________________________________________________________________________________________ 87 Id. at § 4.1. 88 Id. at § 4.1.4. 89 Id. at § 13.0. 90 Id. at § 4.2.1. The CO Code Assignment Certification Worksheet-TN Level (Months-to-Exhaust Worksheet), set forth in Appendix B to the CO Code Guidelines, requests data on telephone numbers available for assignment, growth history for the past six months, and projected demand for the coming 12 months. 91 See CO Code Guidelines at Appendix B n.1. 92 Jeopardy is defined as a situation where the
• http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.txt http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.wp
  • The PICC first took effect in January 1998. The Consumer Price Index (CPI) for interstate toll service dropped from 75.2 in December 1997 to 74.6 in December 1998, or 0.8 percent in absolute terms and 2.4 percent once adjusted for inflation. PHIL CHEILIK, FEDERAL COMMUNICATIONS COMMISSION, REFERENCE BOOK OF RATES, PRICE INDICES AND EXPENDITURES FOR TELEPHONE SERVICE Tbls. 4.1 & 4.2,at 68, 78 (June 1999). The CPI dropped another 4.1 points to 72.5 between December 1998 and May 1999, making the total decline 3.6 percent from December 1997, without adjusting for inflation. See BUREAU OF LABOR STATISTICS, CONSUMER PRICE INDEX-ALL URBAN CONSUMERS: INTERSTATE TOLL CALLS (Series ID: CUUR0000SS27051) (available at the Bureau of Labor Statistics web site, ). 6 10.The Commission
• http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.txt http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.wp
  • capacity owners and do not assign a value to the remaining owners' market shares, given their minimal market presence. 325 See TAINO-CARIB C&MA at Schedule D at 3. 326 The eight largest owners of capacity account for 95.8 percent of the capacity on the route between the U.S. Virgin Islands and Puerto Rico. See id. The remaining owners account for 4.2 percent of the capacity, but none of these remaining owners holds one percent or more of the unassigned capacity. For purposes of calculating the HHI, we use the market shares of the eight largest capacity owners and do not assign a value to the remaining owners' market shares, given their minimal market presence. 327 Because WorldCom's ownership share of foreign
• http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.doc http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.txt
  • Exchange Carrier (CLEC) Interface Change Management Process (dated Sept. 1, 1999) with SWBT Change Agreement (dated Sept. 23, 1999). SWBT's Change Agreement sets forth a timeline for changes to existing interfaces and the introduction of new interfaces. See Change Agreement §§ 3.3.1-3.3.16 (timeline for changes to existing application-to-application interfaces); id. §§ 3.5.1-3.5.10 (timeline for changes to graphical-user interfaces); id. §§ 4.2.1-4.2.18 (timeline for the introduction of new application-to-application interfaces); id. §§ 4.3.1-4.3.12 (timeline for the introduction of new graphical-user interfaces). Changes are divided into two different categories: ``Category One,'' which refers to changes to application-to-application interfaces; and ``Category Two,'' which refers to changes to graphical-user or proprietary interfaces. The Change Agreement specifies the timelines associated with each type of change. In
• http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.doc http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.txt
  • trouble report rates of 15.3 percent, 15.9 percent, and 17 percent for the same period. SWBT's Oklahoma performance is reported as 14.3 percent, which is just above the 12 percent benchmark. See SWBT Aggregated Performance Data (Kansas), Measure No. 69-03 (``Repeat Reports - BRI Loop''), at 271-No. 69a. SWBT's trouble report rates for DSL loops provided to competing carriers were 4.2 percent, 1.7 percent, 2.0 percent, and 3.1 percent for the months of July, August, September, and October 2000 respectively. See SWBT Aggregated Performance Data (Kansas), Measure No. 65-08 (``Trouble Report Rate - DSL - No Line Sharing''), at 271-No. 65c; see also SWBT Reply at 64. See SWBT Aggregated Performance Data (Oklahoma), Measure No. 65-08 (``Trouble Report Rate - DSL
• http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.html http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.pdf http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.txt http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.wp
  • were submitted after USAC submitted its May 1st filing. USAC reported in its May 1st filing that, because several carriers had not yet submitted their Universal Service Worksheet, approximately 18 percent of the end-user telecommunications revenues were based on estimates by USAC. According to USAC, the percent of industry revenues that continues to be based on estimates by USAC is 4.2 percent. Id. 14. Letter from Lisa Rosenblum, USAC, to Magalie Roman Salas, FCC, dated March 18, 1998 (USAC March 18 letter). See also Letter from Robert Haga, USAC, to Magalie Roman Salas, FCC, dated June 12, 1998 (USAC June 12 letter). 15. See USAC June 12 letter. 16. See USAC May 14 letter. 17. 47 C.F.R. 54.709(a)(4). References 1. http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.txt
• http://transition.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp99-1.pdf
  • Lines....................................28 Table 3.3Lines Provided by Large ILECs to CLECs as UNE Loops...................32 Table 3.4Percent of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements...............................36 IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA..............................................43 Table 4.1Local Service Competitors Holding Numbering Codes.....................45 Chart 4.1Local Service Competitors Holding Numbering Codes by LATA on July 1, 1999................................................46 Table 4.2Local Service Competitors Identified..................................47 Table 4.3Numbering Codes Assigned to Local Exchange Carriers....................66 V. TELEPHONE NUMBERS TRANSFERRED AMONG CARRIERS....................67 Table 5.1Telephone Numbers Transferred.....................................69 VI.NEW ENTRANT LOCATOR INFORMATION .................................71 Table 6.1Competitive Access Providers and Competitive Local Exchange Carriers ..............................................73 Table 6.2Local Resellers and Other Local Exchange Carriers.......................81 Table 6.3Long Distance Carriers Reporting Local Revenues........................83 VII.ADDITIONAL INFORMATION SOURCES: LOCAL COMPETITION BY STATE...........................................................85 CONTACTING THE
• http://transition.fcc.gov/Bureaus/Common_Carrier/in-region_applications/bellsouth_sc/bssccom.html
  • here in a single zip file: [5]bsscrpl.zip (938 KB, 31 files, 2.9 MB unzipped). See the [6]Reply Comments Table below for the names of the parties who submitted disks and their associated files. Comments 10/20/97 18 comments were filed electronically with the FCC for this proceeding and are provided here in a single zip file: [7]bssccom.zip (1 MB, 45 files, 4.2 MB unzipped). See the [8]Comments Table below for the names of the parties who submitted disks and their associated files. To download a zip file: click on the highlighted file name above, then use your browser's normal save function to save the zip file to your computer. Once it's on your system, use an [9]unzip program to unzip the downloaded
• http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.txt http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.wp
  • 0.1 0.2 92.1 CALOSANGELES 28 59 182.2 927.0 25452 12719 24863 12621 1.1 0.8 99.6 CALOSANGELES 34 35 70.3 896.0 22216 12586 21279 12427 0.5 1.0 99.7 CALOSANGELES 58 41 55.7 875.0 21665 12534 20290 12096 0.4 0.7 100.0 CAMERCED 51 38 129.4 680.0 21680 1288 20945 1275 0.0 0.0 99.9 CAMODESTO 19 18 238.2 573.0 26692 2695 26692 2748 4.2 1.4 98.3 CAMONTEREY 46 32 50.0 771.0 16201 718 15629 705 0.3 0.2 99.1 CAMONTEREY 67 31 50.0 701.0 14214 1413 12867 716 0.0 0.0 99.7 CANOVATO 68 47 124.2 431.0 20706 4165 18713 3674 0.1 0.0 99.6 CAOAKLAND 2 56 1000.0 479.0 35218 5937 36057 5970 0.0 0.0 92.9 CAONTARIO 46 47 69.9 927.0 17999 12158 17391 11983 0.2
• http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.txt http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.wp
  • 86 (1986). With the exception of the limits on exposure to power density above 1500 MHz and the limits for exposure to lower frequency magnetic fields, these MPE limits are also generally based on the guidelines contained in Section 4.1 of ANSI/IEEE C95.1-1992. We also adopted limits for localized ("partial body") absorption for certain portable transmitting devices based on Sections 4.2.1 and 4.2.2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 8 Federal Communications Commission FCC 97-303 20. The Electromagnetic Energy Association (EEA), U S WEST, Inc. and the Department of Defense (DOD) ask us to reconsider our decision not to adopt the ANSI/IEEE 1992 standard in its entirety.9 The National Association of Broadcasters (NAB) also supports this
• http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.txt http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.txt http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.wp
  • the applicable provisions of [Guide 65] and other standards and guides relevant to testing, inspection Federal Communications Commission FCC 98-338 41See Guide 65, clause 4.4(a) & (b). 42See Retlif comments at 3, Rockwell comments at 2, and Kenwood reply comments at 3. 43See ACIL comments at 3, CCL comments at 2, and Intertek comments at 4. 44See Guide 65, clause 4.2(a) & (o). 45See Guide 65, clause 4.4(b). 11 or other technical activities."41 Thus, TCBs must ensure that subcontractors, which perform their work under the direction of, and generally with compensation from, the TCB, are competent and in compliance. We do not interpret Guide 65 as requiring subcontractors to be Guide 25 accredited. We expect that as a result of our
• http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.doc http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.pdf http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.txt
  • 61.9 Satellite link unavailability for the worst-month % 0.0978 0.3316 0.9361 1.3177 Total link unavailable time for the worst-month minutes 42.8 145.2 421.8 577.1 10% of the unavailable time in the worst-month minutes 4.3 14.5 42.2 57.7 5% of the unavailable time in the worst-month minutes 2.1 7.26 21.1 28.9 2.86% of the unavailable time in the worst-month minutes 1.2 4.2 12.1 16.5 Rainy sky C/I for a 2.86% increase in link unavailability dB 24.2 22.9 25.0 22.3 APPENDIX H -- A METHOD OF CONVERTING PERCENTAGE OF UNAVAILABLE TIME INTO A CARRIER-TO-INTERFERENCE RATIO This appendix presents a method for determining the relationship between DBS service outage time and a DBS system's carrier-to-noise plus interference ratio (C/N+I). Specifically, this method can be
• http://transition.fcc.gov/Bureaus/International/Orders/1997/fc97280d.pdf
  • Component Prices International International National Tariffed Country Transmission Switching Extension Component Price Argentina 6.7¢ 3.4¢ 22.0¢ 32.1¢ Australia 4.8¢ 1.9¢ 12.0¢ 18.7¢ Austria 8.1¢ 1.9¢ 21.4¢ 31.4¢ Bahamas 5.2¢ 1.9¢ 12.8¢ 19.9¢ Barbados 8.6¢ 3.4¢ Zero 12.0¢ Belgium 3.0¢ 1.9¢ 9.2¢ 14.1¢ Bermuda 4.5¢ 1.9¢ 3.5¢ 9.9¢ Brazil 6.6¢ 3.4¢ 17.8¢ 27.8¢ Chile 2.9¢ 3.4¢ 12.3¢ 18.6¢ China 8.7¢ 4.8¢ 4.2¢ 17.7¢ Colombia 5.1¢ 4.8¢ 8.6¢ 18.5¢ Costa Rica 3.3¢ 4.8¢ 2.2¢ 10.3¢ Czech Republic 8.1¢ 3.4¢ 7.5¢ 19.0¢ Denmark 5.9¢ 1.9¢ 6.6¢ 14.4¢ Dominican Republic 3.6¢ 4.8¢ 6.1¢ 14.5¢ Ecuador 2.9¢ 4.8¢ 2.6¢ 10.3¢ Egypt 10.4¢ 4.8¢ 2.0¢ 17.2¢ El Salvador 5.9¢ 4.8¢ 1.1¢ 11.8¢ France 2.9¢ 1.9¢ 12.7¢ 17.5¢ Germany 4.3¢ 1.9¢ 13.6¢ 19.8¢ Greece 5.2¢ 3.4¢ 14.4¢ 23.0¢
• http://transition.fcc.gov/Bureaus/International/Orders/1997/fc97280e.pdf http://transition.fcc.gov/Bureaus/International/Orders/1997/fc97280e.txt http://transition.fcc.gov/Bureaus/International/Orders/1997/fc97280e.wp
  • 10.4¢ Poland 4.7¢ El Salvador 5.9¢ Portugal 4.6¢ France 2.9¢ Russia 5.4¢ Germany 4.3¢ Singapore 5.0¢ Greece 5.2¢ South Africa 5.2¢ Guatemala 3.1¢ Spain 4.8¢ Guyana 6.6¢ Sweden 3.6¢ Haiti 8.6¢ Switzerland 4.4¢ Honduras 3.1¢ Taiwan 5.7¢ Hong Kong 5.1¢ Thailand 4.0¢ Hungary 6.1¢ Trinidad 3.6¢ India 8.1¢ Turkey 5.4¢ Indonesia 6.8¢ U.A.E. 3.3¢ Ireland 2.7¢ United Kingdom 2.4¢ Israel 4.2¢ Uruguay 12.7¢ Italy 4.8¢ Venezuela 3.7¢ Jamaica 2.9¢ Vietnam 9.3¢ Japan 6.5¢ B. International Switching Facility Tariffed Component Prices There is little information in the public domain concerning the international switching facility component. Carriers in Sweden and the United Kingdom have termination tariffs which could serve as a reference point for international switching costs incurred by a correspondent but these
• http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.pdf http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.txt http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/209958-2.pdf
  • Content-Type: text/plain Content-Transfer-Encoding: 8bit SAMPLE "A" Volume Control Range RECEIVE Volume Control Range ROLR Def 48+-5 TlA470 4.2.2 8 4.2.2.3 RI FBl ROLR Max Tone=Mid Amp Off/ON Vol=MAX SPL 1 kHz Def Vol SAMPLE "A" SPL 1 kHz Max Vol 42.26 d0 22.69 d0 95.60 dB SPL 116.20 dB SPL 4o.w dB P&W 20.00 10.00 0.00 -lo.w \! 100 200 500 lk 2k 5k 10k . Figure 3 SAMPLE "A" Volume Control Range Volume Control Evaluation - 6ofl6
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/209968-1.pdf
  • should require a manufacture or provider to modify its equipment or service only when the company substantially changes or upgrades its product. Such an approach would be consistent with the recommendation of the Telecommunications Access Advisory Committee. See Telecommunications Access Advisory Committee, Final Report, Access to Telecommunications Equipment and Customer Premises Equipment by Individuals with Disabilities, January 1997, at § 4.2. SBC Communications Inc.: June 30, 1998 Page 28 K. The FCC Should Encourage the Telecommunications Industry To Develop Other Measures To Increase Accessibility to Individuals with Disabilities [NPRM ¶ 174] In the NPRM, the FCC asks whether there are other measures that it might take to increase accessibility to telecommunications products and services -- for example, by establishing a clearinghouse
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210007-2.pdf
  • 20.7 18.8 Figure2: Summary of Measurements 31 .o 56.6 -44.1 52.0 28.5 87.7 111.5 23.5 23.9 - 2.5 - Note: Since ROLR and TOLR are calculated using losses the more neaative the ROLR or TOLR the louder the telephone. - 26 - SAMPLE "A" Volume Control Range -1;/1 BruelgKjaerETS5302Ver 2 52 __ RECEIVE Volume Control Range ROLR Def 46+-5 TIA470 4.2.2 & 4.2.2.3 Rl FBl HOLH Max Tone=Mid Amp Off/ON Vol=MAX SPL 1 kHz Def Vol SAMPLE "A" :;Pl 1 xHz Max Vol -1 40.00 18 PaN 30 00 0.00 -10.00 L--.- ' I I 42.26 dB 100 200 500 ik 2k 5k 10k 1:-- 2:- Frequency(Hz) Figure3 SAMPLE "A" Volume Control flange - 27 - SAMPLE "6" Volume Control Range
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210097-1.pdf
  • obligations on the design, development, and fabrication of equipment and CPE, technical feasibility must be assessed at the time the design, development and fabrication process for a new product or a substantial upgrade for an existing product begins. Retrofitting separate factor). 62 47 C.F.R. § 68.317. 63 See Section III.B.4., n. 40, supra. 64 36 C.F.R. § 1193.2; TAAC § 4.2. 65 See NPRM ¶ 120. 50 products that have already begun the design process should not be required under any circumstances.66 Any requirement to retrofit would waste limited compliance resources, delay product time to market, and slow the pace of innovation in a rapidly changing marketplace where products quickly become obsolete. Any enforcement strategies utilized by the FCC should be
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210104-1.pdf
  • periods of time.37 Redesigning products that have already been designed to take into account the latest technological developments should not be required under any circumstances.38 Any 34 See NPRM at ¶ 102 (discussing Access Board's decision not to recognize feasibility as a separate factor). 35 NPRM ¶ 101. 36 See NPRM ¶ 120. 37 36 C.F.R. § 1193.2; TAAC § 4.2. 38 See id. -37- redesign requirement would deplete limited compliance resources, delay product time to market, and slow the pace of innovation in a rapidly changing marketplace where products quickly become obsolete. For the same reason enforcement strategies utilized by the FCC should be proactive rather than punitive, directed towards increasing the availability of accessible equipment and CPE in the
• http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/213263-1.pdf
  • a legal matter, commenters correctly note that retroactivity is "generally disfavored in the law" because it can "deprive citizens of legitimate expectations and upset settled 11/ See comments of GTE at 10; SBC Communications, Inc. ("SBC") at 27, citing Access to Telecommunications Equipment and Customer Premises Equipment by Individuals with Disabilities, Final Report, Telecommunications Access Advisory Committee (Jan. 1997) 3 4.2; CTIA at 10-l 1; see also comments of Personal Communications Industry Association ("PCIA") at 18. &J/ For example, in attempting to implement the Hearing Aid Compatibility Act of 1988, the Commission suspended and replaced substantial portions of its implementing regulations in large part because of public concerns over the costs of retrofitting or replacing telephones to comply with those regulations.See
• http://transition.fcc.gov/Bureaus/Wireline_Competition/Orders/2002/fcc02118.pdf
  • 3.4 8.29 4.78 9.07 6.64 7.61 6.22 MR-3-02- 2110 % Missed Repair Appointment ­ Central Office Bus. 12.34 13.13 14.46 11.57 14.51 13.04 9.04 8.08 9.64 8.53 MR-3-02- 2120 % Missed Repair Appointment ­ Central Office Res. 6.49 3.23 8.48 3.33 8.73 11.11 6.59 0 5.73 14.29 MR-3-03- 2100 % CPE/TOK/FOK - Missed Appointment 5.86 6.79 5.68 10.53 5.89 7.31 4.2 4.73 MR-3-04- 2100 % Missed Repair Appointment - No Double Dispatch 5.48 3.11 4.85 3.32 MR-3-05- 2100 % Missed Repair Appointment - Double Dispatch 43.07 30.09 40.88 30.97 MR-4 ­ Trouble Duration Intervals MR-4-01- 2100 Mean Time To Repair ­ Total 20.94 13.91 18.83 13.22 17.12 12.96 18.31 13.1 16.74 12.31 MR-4-02- 2110 Mean Time To Repair ­ Loop Trouble
• http://transition.fcc.gov/Reports/fcc21cht.pdf
  • Investment Average Subscriber Bill Wait for Licenses 60.8 Million Subscribers in 1998113,111 Jobs in 1998 $50.2 Billion Invested as of 1998 $39.88 Dollars Per Month in 1998 7.8 Months From Application to Grant Source: CTIA June 1998 Survey; FCC Report to Congress on Spectrum Auctions, September 30, 1997. 4 13.5 5.8 13.2 5.5 12.4 5.4 12 5.1 11.5 4.6 10.2 4.2 0 2 4 6 8 10 12 14 Aver age Pr ice/ Co st per Minu te, i n C ent s 1992 1993 1994 1995 1996 1997 LD Consumer Prices and Access Costs are Falling* LD Consumer Prices Access Costs * As measured in average cents per conversation minute. LD consumer prices are based on all interstate and international
• http://transition.fcc.gov/Reports/trends.pdf
  • 1993 1994 1995 1996 1997 1998* Communications Services Revenues Wireline Wireless Radio & TV Cable * 1998 aggregate figure is an IAD estimate. Specific 1998 estimates for the different communications services segments were not available. Sources: IAD, Telecommunications Industry Revenue Report; Census Bureau, Annual Survey of Communications Services. 3 13.5 5.8 13.2 5.5 12.4 5.4 12 5.1 11.5 4.6 10.2 4.2 0 2 4 6 8 10 12 14 Aver age P rice /Co st per Minut e, i n C ent s 1992 1993 1994 1995 1996 1997 LD Consumer Prices and Access Costs are Falling* LD Consumer Prices Access Costs * As measured in average cents per conversation minute. LD consumer prices are based on all interstate and international
• http://transition.fcc.gov/eb/FieldNotices/2003/DOC-239292A1.html
  • also respond to reports of unlit towers. The FAA also routinely notifies Commission field offices when owners fail to report that lights have been repaired. On July 25, 2002, an agent from the Detroit Office conducted an inspection of the antenna structure located on Webb Ridge Road 0.14 miles east of the intersection of Webb Ridge Road and KY-59, approximately 4.2 miles northwest of Olive Hill, Kentucky. The agent observed no ASR number posted at the site. A search of Commission records and subsequent contacts with FrontierVision revealed that the antenna structure was subject to Part 17 of the Rules, was not registered, and accordingly, needed to be registered. 4. On July 26, 2002, an agent from the Detroit Office conducted
• http://transition.fcc.gov/eb/FieldNotices/2003/DOC-268625A1.html
  • must be periodically calibrated so as to provide reliable indications of transmitter operating parameters with a known degree of accuracy." During the inspection, the agent determined that WSNR failed to calibrate its remote monitoring system so that it provided reliable indications of the transmitter's common point current. The station's remote monitoring system indicated a common point current value that was 4.2 percent below the value indicated on the transmitter's common point current meter. Entries in the station log over several months showed similar inaccurate readings. d. 47 C.F.R. S 73.1590(a)(6): "The licensee of each AM, FM, TV and Class A TV station, except licensees of Class D non-commercial educational FM stations authorized to operate with 10 watts or less output power,
• http://transition.fcc.gov/eb/Orders/2002/FCC-02-156A1.html
  • The Complaint asserts that AACR's draft agreement contained pricing terms that differed substantially from those proposed by Tricom S.A. Specifically, AACR's draft agreement allegedly set forth a rate of 1.1 cents per minute for local termination of international calls to Tricom S.A. customers, known as the ``international access charge,''31 while Tricom S.A.'s proposed agreement specified an international access charge of 4.2 cents.32 By May 2001, Tricom S.A. and AACR purportedly had failed to reach an interconnection agreement, and Tricom S.A. still had not activated the T-1 lines that AACR purchased in December 2000.33 The Complaint avers that, on May 2, 2001, AACR filed a petition with INDOTEL asking INDOTEL to intervene in AACR's interconnection dispute with Tricom S.A.34 The Complaint advances
• http://transition.fcc.gov/eb/Orders/2003/DA-03-2613A1.html
  • 10, 46; Complaint, Exhibit 8 (Bagley Declaration) at 2, 8. 69 Implementation of the Local Competition Provisions in the Telecommunications Act of 1996, CC Docket No. 96-98, Interconnection Between Local Exchange Carriers and Commercial Mobile Radio Service Providers, CC Docket No. 95-185, Order on Reconsideration, 14 FCC Rcd 18049, 18086, 107 (1999) (emphasis added). 70 Complaint, Exhibit 6 (New Contract), 4.2. 71 Complaint at 12, 54-55. See also Reply at 36-37. 72 Response at 18 & Exhibit F (Declaration of Obie Youngblood [``Youngblood Declaration'']) at 2, 9; Exhibit G (Declaration of Ron Marshall [``Marshall Declaration'']) at 2, 5; Exhibit K Davis Declaration at 4-5, 16-18. Neither the Response nor the declarations accuse the Cable Operators specifically of making unauthorized attachments. 73
• http://transition.fcc.gov/eb/Orders/2007/DA-07-2279A1.html
  • Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications Commission, dated July 13, 2005 (attaching the affidavit of Caroline Beasley, Vice President and Chief Financial Officer of Beasley Broadcast Group) filed
• http://transition.fcc.gov/eb/Orders/2010/DA-10-1258A1.html
  • 9, 2009) ("LOI Response"). 47 C.F.R. S: 4.9(f). See also supra, P: 4. 2004 Network Outage Order, 19 FCC Rcd at 16868 P: 69. See id. at 16834 P: 3, 16868 P:P: 73-75. In the 2004 Network Outage Order, the Commission afforded confidential treatment to network outage reports. 2004 Network Outage Report, 19 FCC Rcd at 16853-55, P:P: 42-46. Section 4.2 of the Rules specifically states that Part 4 outage reports "will be presumed to be confidential" and that public access to outage reports may be sought only pursuant to the procedures set forth in Section 0.461 of the Rules which addresses requests for inspection of materials not routinely available for public inspection. 47 C.F.R. S: 4.2; see also 47 C.F.R.
• http://transition.fcc.gov/eb/Orders/da002431cd.doc http://transition.fcc.gov/eb/Orders/da002431cd.html http://transition.fcc.gov/eb/Orders/da002431cd.txt
  • the Enforcement Bureau of its inquiry into whether QUALCOMM may have violated the Commission's rules, and in accordance with the terms of this Consent Decree, QUALCOMM agrees to the following terms, conditions and procedures regarding compliance with Section 22.921. For the purposes of this Consent Decree, the following definitions shall apply: 4.1 ``Commission'' or ``FCC'' means the Federal Communications Commission; 4.2 ``Bureau'' means the Enforcement Bureau of the Federal Communications Commission; 4.3 ``QUALCOMM'' means QUALCOMM Incorporated; 4.4 ``Parties'' means QUALCOMM and the Bureau; and 4.5 ``Adopting Order'' means an order of the Bureau adopting the terms and conditions of this Consent Decree. The Parties agree that the provisions of this voluntary Consent Decree shall be subject to final approval by the
• http://transition.fcc.gov/fcc-bin/audio/DA-06-1007A1.doc http://transition.fcc.gov/fcc-bin/audio/DA-06-1007A1.pdf
  • in order to protect Channel 232C1 in Montreal, Quebec. Channel 282C3 at Keeseville, New York, has been accepted as a specially negotiated short-spaced allotment, with the following restrictions: the allotment is limited to 21.3 kilowatt (kW) ERP and 100 meters of antenna HAAT or the equivalent along the 16.9 degree azimuth towards Channel 282C1 in Trois-Rivieres, Quebec, and limited to 4.2 kW ERP and 100 meters of antenna HAAT or the equivalent along the 337 degree azimuth to protect Channel 281B, St. Jean, Quebec, and limited to 6.3 kW ERP and 100 meters of antenna HAAT or the equivalent along the 329 degree azimuth in order to protect channel 283B in Cornwall, Ontano. 7. The Commission will send a copy of
• http://transition.fcc.gov/fcc-bin/audio/DA-11-324A1.doc http://transition.fcc.gov/fcc-bin/audio/DA-11-324A1.pdf
  • and 0.283, IT IS ORDERED That, effective April 4, 2011, the FM Table of Allotments, 47 C.F.R. Section 73.202(b), IS AMENDED, with respect to the community listed below, to read as follows: Community Channel Willow Creek, California 258A The reference coordinates for FM Channel 258A at Willow Creek, California, are 40-57-29 NL and 123-42-23 WL, at a site 6.7 km (4.2 miles) west of the community. 6. IT IS FURTHER ORDERED, That the Form 301 application filed by Miriam Media, Inc., for FM Channel 254C1 at Loleta, California, File No. BNPH-20070406ABY, IS GRANTED. 7. IT IS FURTHER ORDERED, That the Secretary of the Commission shall send by Certified Mail, Return Receipt Requested, a copy of this Order to the following counsel
• http://transition.fcc.gov/ib/sand/mniab/traffic/files09/CREPOR09.pdf
  • 0.0 0.0100.0 4,919,219 0.0 0.0 0.0 0.0100.0 Antigua and Barbuda $4,778,879 0.0 0.0 0.1 0.0 99.9 $27,210 0.0 0.0 0.0 0.0100.0 $76,953 0.0 0.0 0.0 0.0100.0 40,464,066 0.0 0.0 0.1 0.0 99.9 Aruba $3,769,894 0.0 0.0 0.6 0.0 99.4 $52,022 0.0 0.0 0.0 0.0100.0 $169,628 0.0 0.0 0.0 0.0100.0 33,521,607 0.0 0.0 0.5 0.0 99.5 Bahamas, The $8,995,903 0.0 0.0 4.2 0.0 95.8 $699,678 0.0 0.0 0.0 0.0100.0 $2,771,972 0.0 0.0 0.0 0.0100.0 175,983,154 0.0 0.0 9.8 0.0 90.2 Barbados $8,718,680 0.0 0.0 0.1 0.0 99.9 $932,944 0.0 0.0 0.0 0.0100.0 $1,579,634 0.0 0.0 0.0 0.0100.0 97,690,206 0.0 0.0 0.1 0.0 99.9 Bermuda $3,672,469 0.0 0.0 0.3 0.0 99.7 $496,398 0.0 0.0 0.0 0.0100.0 $5,602 0.0 0.0 0.0 0.0100.0 83,643,765 0.0
• http://transition.fcc.gov/ib/sand/mniab/traffic/files10/CREPOR10.pdf
  • 0.0 0.0100.0 35,298,908 0.0 0.0 0.0 0.0100.0 Zambia $1,697,479 0.0 0.0 0.0 18.7 81.3 $54,097 0.0 0.0 0.0 0.0100.0 $428,690 1.7 0.0 0.0 0.0 98.3 18,246,401 0.0 0.0 0.0 25.9 74.1 Zimbabwe $9,856,813 0.0 0.0 0.0 2.4 97.6 $341,985 0.0 0.0 0.0 0.0100.0 $1,739,133 0.9 0.0 0.0 0.0 99.1 42,765,380 0.0 0.0 0.0 2.5 97.5 Africa $395,105,535 0.2 0.0 0.3 4.2 95.3 $13,849,145 0.0 0.0 0.0 0.0100.0 $47,065,054 3.5 0.0 0.0 0.0 96.5 2,682,055,473 0.3 0.0 0.1 5.4 94.1 Bahrain $1,865,267 0.9 0.0 0.0 1.6 97.5 $101,166 0.0 0.0 0.0 0.0100.0 $724,229 5.6 0.0 0.0 0.0 94.4 31,132,030 1.2 0.0 0.0 3.6 95.3 Iran $9,379,717 0.2 0.0 0.1 15.4 84.3 $1,062,017 0.0 0.0 0.0 0.0100.0 $60,28024.7 0.0 0.0 0.0 75.3 133,886,742
• http://transition.fcc.gov/ownership/materials/already-released/localismwelfare060005.pdf
  • {(1 23+23 )+ ³13 43 ´} 0( 1)=0 Inserting =12+ 6 indicatesthisisjustalinearequationinquality di erences,namely µ1 2 6 µ 1 3+ 4 3 ¶¶ = 0( 1) (23) Byasimilartoken,themassproducer'squalityshould(second-best)opti- mallybe: P = {( )(1 23+23 )+(1 )³23 23 ´} 0( 0). Solvingoutinasimilarmannertothataboveyields: P = µ1 2+ 6 µ 1 3+ 4 3 ¶¶ = 0( 0) (24) Wecannowcomparetheoptimalsolutionfrom(23)and(??)totheequi- libriumonefrom(21)and(22).Todoso,itisfirstinstructivetoconsiderthe case =1. 4.2The"pricing"solution When =1,thenuisancecosttoviewersfromadvertisingisexactlyequalto thesocialbenefittoadvertisers(recallthatthesocialbenefithasbeensetto 1).Hence,inthiscase,thesolutionisjustasiftherewasadirectprice,for instanceasubscriptionpricetotheserviceso ered.Toseethis,itsu cestoset =1intheaboveequations,andreadthe variablesasdirectpricesfaceby consumersandsetbyfirms.Theimportantinsightfromthisisthebenchmark thattheoptimumandequilibriumconditionsareexactlythesame.Namely, theequations(21)and(22)and(23)and(??)reducetothesamething.This meansthatoptimumandequilibriumqualityprovisionexactlycoincide. Theintuitionisasfollows.Whenaproducersetsqualityandpricestogether, anyincrementalqualitycanbeimmediatelymonetizedandleavesharesineach 10 marketunchanged.Forexample,raisingqualitybyoneunitandraisingprice byoneunitwillchangenoconsumer'sutilityandthereforenotchangethe producer'smarket.Therefore,qualityprovisionisoptimal.3 Thisisausefulbenchmarkcasebecausewecannowseehowthemarket equilibriumandoptimumsolutionsarea ectedbyraising aboveone.This willcorrespondtoacasewhereadvertisingisanuisancerelativetoitssocial value(atthemargin). 4.3Comparingoptimumandequilibrium Forthegeneralcase,itismoretransparenttoanalyzetheequilibriumand optimumforsymmetriclocalmarkets.Therefore,setthemallequalwithsize 1,andlettherebe ofthem.Thequalitiesinalllocalmarketsarethenthe same.Let denotethequalitydi erence, 0 1. Considerfirsttheequilibrium.Theconditionsforthelocalfirmsare 1 2 6 = 0( 1) (25) whilethemass-producerfirmfaces µ1 2+ 6 ¶ = 0( 0) (26) Thecaseofanexponentialcostfunctionisausefulbenchmark.Thenwehave thattheratioofthetwoequationsabove(whichdeterminestheequilibrium ) isindependentof .Hencetheequilibrium isindependentof .Lookingatthe equationsandtaking
• http://transition.fcc.gov/ownership/materials/already-released/review090001.pdf
  • While the number of radio stations has grown, the number of radio owners has declined by 6.7 percent from March 1996 to November 1997 (from 5,133 to 4,788 owners), by an additional 5.8 percent from November 1997 to November 1998 (from 4,788 to 4,512), by another 11.2 percent from November 1998 to March 2000 (from 4,512 to 4,006), and by 4.2 percent from March 2000 to March 2001 (from 4,006 to 3,836). As of March 2001, there were 3,836 owners of commercial radio stations across the nation, for a cumulative decline in the number of owners of 25 percent since March 1996. The decline in the number of owners reflects a general continuation of the consolidation of the commercial radio industry
• http://transition.fcc.gov/ownership/materials/already-released/survivor090002.pdf
  • high year 2000 margins of ABC compared to NBC probably do Television Station Advertising Volume Broadcast Advertising Revenue Total Commercial Television Stations TV Station Advertising Revenue per Station in Current Dollars Broadcast Advertising Revenue Per Station in Current Dollars Television Station Advertising Revenue per Station in Constant Dollars Broadcast Advertising Revenue per Station in Constant Dollars 1975 2,957 5,263 706 4.2 7.5 7.8 13.9 1980 6,236 11,416 734 8.5 15.6 10.3 18.9 1985 11,718 20,298 883 13.3 23.0 12.3 21.4 1990 15,644 26,616 1092 14.3 24.4 11.0 18.6 1991 14,675 25,461 1098 13.4 23.2 9.8 17.0 1992 15,630 27,249 1118 14.0 24.4 10.0 17.4 1993 16,235 28,020 1138 14.3 24.6 9.9 17.0 1994 18,457 31,133 1145 16.1 27.2 10.9 18.3 1995
• http://transition.fcc.gov/ownership/roundtable_docs/waldfogel-b.pdf
  • 0.0 0.0 Album Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemp. Hit Radio (CHR, top40) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7
• http://transition.fcc.gov/ownership/roundtable_docs/waldfogel-c.pdf
  • 0.0 0.0 Album Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemporary Hit Radio (CHR) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5
• http://wireless.fcc.gov/auctions/05/releases/d980547a.pdf
  • with the transactions contemplated by this Term Sheet. 4 CAPITAL: By the date (the "Confirmation Date") on which the Court enters an order (the "Confirmation Order") confirming the Plan, NEWGSM Co. will have the following commitments for capital conditioned solely upon the occurrence of the Effective Date: 4.1 COMMON EQUITY: 4.1.1the "Initial Equity Investment" 4.1.2[Redacted] 3 4.1.3[Redacted] 4.1.4[Redacted] 4.1.5[Intentionally omitted] 4.2 SUBORDINATED DEBT: 4.2.1the "Initial Purchase Commitment" 4.2.2[Redacted] 4.3 VENDOR FINANCING: 4.3.1[Redacted] 5 ASSUMED DEBT: As part of the Plan, the DIP Lenders shall cause the following obligations to be assumed on the Effective Date in the manner set forth below: 5.1 FCC LICENSE PAYMENTS: 5.1.1The New Licensees shall make quarterly payments to the United States in accordance with Schedule 5.1.1
• http://wireless.fcc.gov/auctions/17/releases/d980230.pdf
  • installation disks for the FCC Mock Bidding System, go to File Manager, open the file folder to which you extracted the software, double-click on backup.bat, and follow the instructions on the screen. Running the FCC Mock Bidding System When the FCC Mock Bidding System has been installed, you will have a new Program Manager group called FCC Mock Bidding System v4.2 with the following icons: FCC Mock Bidding System, Readme file, and Uninstall. If you have Windows 3.1 or 3.11, the group will also contain icons for Configure PPP and PPP Dialer. Important: Disable any screen saver software before using the FCC Mock Bidding System. 7 For technical assistance with installing or using the FCC Mock Bidding System, contact the FCC
• http://wireless.fcc.gov/auctions/17/releases/d980230e.pdf http://wireless.fcc.gov/auctions/17/releases/d980230e.txt http://wireless.fcc.gov/auctions/17/releases/d980230e.wp
  • installation disks for the FCC Mock Bidding System, go to File Manager, open the file folder to which you extracted the software, double-click on backup.bat, and follow the instructions on the screen. Running the FCC Mock Bidding System When the FCC Mock Bidding System has been installed, you will have a new Program Manager group called FCC Mock Bidding System v4.2 with the following icons: FCC Mock Bidding System, Readme file, and Uninstall. If you have Windows 3.1 or 3.11, the group will also contain icons for Configure PPP and PPP Dialer. Important: Disable any screen saver software before using the FCC Mock Bidding System. 7 For technical assistance with installing or using the FCC Mock Bidding System, contact the FCC
• http://wireless.fcc.gov/auctions/24/releases/pt1_pt90.pdf http://wireless.fcc.gov/auctions/24/releases/pt1_pt90.wp
  • degrees 28' 26.2"......97 degrees 31' 05.1" Nashville-Davidson, Tennessee...........36 degrees 09' 33.2"......86 degrees 46' 55.0" Toledo, Ohio/Michigan................41 degrees 39' 14.2"......83 degrees 32' 38.8" New Haven, Connecticut...............41 degrees 18' 25.3"......72 degrees 55' 28.4" Honolulu, Hawaii...................21 degrees 18' 48.6"......157 degrees 51' 50.1" Jacksonville, Florida..................30 degrees 19' 44.9"......81 degrees 39' 41.3" Akron, Ohio.......................41 degrees 05' 00.2"......81 degrees 30' 43.4" Syracuse, New York.................43 degrees 03' 04.2"......76 degrees 09' 12.7" Worcester, Massachusetts..............42 degrees 15' 37.3"......71 degrees 48' 15.3" Tulsa, Oklahoma....................36 degrees 09' 12.3"......95 degrees 59' 35.0" Allentown-Bethlehem-Easton, PA/NJ.......40 degrees 36' 11.4"......75 degrees 28' 04.7" Richmond, Virginia..................37 degrees 32' 15.5"......77 degrees 26' 07.9" Orlando, Florida....................28 degrees 32' 43.0"......81 degrees 22' 37.3" ----------------------------------------------------------------------------------------------------------------------------------------- Urban area North latitude ................................ West longitude ----------------------------------------------------------------------------------------------------------------------------------------- Charlotte, North Carolina..............35 degrees 13' 44.5"......80 degrees 50'
• http://wireless.fcc.gov/auctions/53/releases/fc000418.pdf http://wireless.fcc.gov/auctions/53/releases/fc000418.txt
  • 61.9 Satellite link unavailability for the worst-month % 0.0978 0.3316 0.9361 1.3177 Total link unavailable time for the worst-month minutes 42.8 145.2 421.8 577.1 10% of the unavailable time in the worst-month minutes 4.3 14.5 42.2 57.7 5% of the unavailable time in the worst-month minutes 2.1 7.26 21.1 28.9 2.86% of the unavailable time in the worst-month minutes 1.2 4.2 12.1 16.5 Rainy sky C/I for a 2.86% increase in link unavailability dB 24.2 22.9 25.0 22.3 Table 2 DIRECTV @ 101 WL DBS satellite orbital location degrees 101.0 101.0 101.0 101.0 Earth station location Denver, CO Washington, D.C. Seattle, WA Miami, FL DBS satellite e.i.r.p. towards the Earth station location dBW 49.4 52.4 48.4 53.4 Earth station elevation above
• http://wireless.fcc.gov/auctions/56/resources/Canadianagreement.pdf
  • to develop sharing agreements that will facilitate reasonable and timely development of broadband wireless systems.3 These agreements should allow for the provision of service by each licensee within its licensed service area to the maximum extent possible. If there is a sharing agreement between the licensees, that agreement shall be followed rather than the coordination process set forth in Section 4.2. 4.2 Coordination in the Absence of a Sharing Agreement - If there is no sharing agreement between the licensees, then proposed facilities shall be coordinated on an individual basis according to the process described below.4 4.2.1The following power flux density (pfd) levels shall apply: 4.2.1.a Power flux density A (`pfd A') has a value of -114 dBW/m2 in any 1
• http://wireless.fcc.gov/auctions/conferences/combin2000/releases/98540191.pdf
  • Combo auction outperforms the SMR with average efficiency gains ranging from 16% - 22%. The largest gain occurs in the high synergy case. The rank sum statistics for each superadditive environment is Z=9.76 (low), Z=8.75 (medium), Z=12.36(high) which are significant at less than 1%. In Figures 4.1.2.a-c we supply the distributions of efficiencies for each superadditive value environment. 16 Figure 4.2.1a: Cumulative Distributions Low Synergy 0 0.2 0.4 0.6 0.8 1 20 40 60 80 100 % Efficient % of Observations SMR Combinatorial Figure 4.2.1b: Cumulative Distributions Medium Synergy 0 0.2 0.4 0.6 0.8 1 20 40 60 80 100 % Efficient % of observations SMR Combinatorial Figure 4.2.1c: Cumulative Distributions High Synergy 0 0.2 0.4 0.6 0.8 1 20 40
• http://wireless.fcc.gov/auctions/conferences/combin2000/releases/98540193.pdf
  • significant negative effect on efficiency. All other variables are statistically insignificant. 18 It was necessary for us to have cases with different numbers of bidders due to the possibility of bankruptcy eliminating some participants. 23 Thus we find that under superadditive value conditions flexibility provides an important boost to efficiency, while increased density of package overlaps tends to decrease efficiency. 4.2 Revenues The amount of revenue generated from a particular auction mechanism depends, in part, on the distribution of license valuations across active bidders. This distribution is altered by changes in the number of bidders in the auction: for example, when financial difficulties occur and a bidder decides or is forced to leave. One method of controlling for the confounding effect
• http://wireless.fcc.gov/auctions/conferences/combin2000/releases/cr_2.pdf
  • gamed successfully in a typical laboratory environment will survive gaming in the FCC environment, or that the absence of collusion in the laboratory will predict the same in the FCC auctions. For conclusions of that sort, a careful analysis of gaming opportunities is necessary. Both experiments and theoretical analysis can be useful guides for forecasting bidder behavior in complex situations. 4.2 Comparing Theoretical Predictions to Experimental Evidence The following observations compare outcomes from two auction designs: a simultaneous ascending auction with individual bidding and a simultaneous ascending auction with package bidding and a standby queue. Observation 1: The experimental evidence is consistent with the theoretical predictions about both the exposure problem with individual bidding (efficient packages are often missed) and the
• http://wireless.fcc.gov/auctions/conferences/combin2000/releases/cr_3.pdf
  • Unless there is a strong perception that free-rider problems are present on all levels, we suggest using just a single discount. In the example above, our sense is that if a bid discount is applied equally and only to BTA and MTA bids, it would be sufficient to address much of the strategic problem that arises from the free-rider issue. 4.2 Minimum Bid Increments The original SAA rule limiting bids on individual licenses to be at least the maximum of x percent above the standing high bid and a specified dollar amount per point does not need to be changed. However, with package bidding and the bulletin board, some modifications are necessary for other types of bids. Minimum improvement levels should
• http://wireless.fcc.gov/auctions/conferences/combin2000/releases/plott.pdf
  • B Actual outcome at 98% efficiency. The inefficiency is due to misallocations of the second six items, which are of low value. Only I and K are in the wrong hands. The colors represent bidders and not whether a package is involved. 19990625-2 0 10 20 30 40 50 60 70 80 90 100 1.2 2.1 2.2 3.1 3.2 4.1 4.2 5.1 5.2 6.1 6.2 7.1 7.2 8.1 8.2 Round.Phase 990605-2 0 200 400 600 800 1000 1200 1400 1600 0 500 1000 1500 2000 2500 3000 3500 4000 Time (seconds) Amount Revenue Total Value Sealed Bid Phase Continuous Phase 34 items 8 people package incentives 990705-1 0 1000 2000 3000 4000 5000 6000 7000 8000 9000 10000 0 1000 2000
• http://wireless.fcc.gov/auctions/conferences/combin2001/papers/ausubel-milgrom.pdf
  • + Bernheim and Whinston (1986) have shown that the set of payoffs consistent with coalition-proof equilibrium in their "menu auctions" is precisely the set of points (,) CoreLw p that minimize the seller's revenue. According to Theorem 3, the payoff outcome of the benchmark limit auction with straightforward bidding is also a coalition- proof equilibrium payoff of the menu auction. 4.2 When Buyers are Mutual Substitutes We turn next to the question of when the structure of the core leads to a coincidence of interests among the bidders, in the sense that there is a single point that is unanimously preferred by all. As reviewed earlier, this characterization does hold in many matching models. Those models typically assume that players on
• http://wireless.fcc.gov/auctions/conferences/combin2001/papers/combexch.pdf
  • widerangeofbiddinglanguages(asdescribedinSection2).Eachagentmayperforma numberofbuysandsells,dependingonitsbidsandasksandthebidsandasksofother agents. Constraints(BB')and(IR')overthediscountallocationwerefirstintroducedinSection 2.2.(BB')givesworst-case(orexpost)budget-balance,suchthattheexchangenevermakes anetpaymenttoagents.Thisconstraintcanbeeasilystrengthenedifitisdesirablefor themarket-makertotakeasliverofthesurplusbeforecomputingthediscounts.The(IR') constraintsensurethattruthfulbidsandasksare(expost)individual-rationalforanagent, suchthatanagenthasnon-negativeutilityforparticipationwhateverthebidsandasks receivedbytheexchange.11 Constraints(VD)ensurethatnoagentreceivesmorethanitsVickreydiscount.The constraintsarenotredundantforcertaindistancemetrics,suchastheLRE(·)metric. InadditiontothestandardL2( , vick)= i( vick,i- i)2and L ( , vick)=maxi( vick,i- i)distancemetrics,wealsoconsiderthefollowingfunc- tions:(a)LRE( , vick)= i vick,i- i vick,i,arelativeerrorfunction;(b)L ( , vick)= i vick,i i,aproducterrorfunction;(c) LRE2( , vick)= i( vick,i- i)2 vick,i ,asquaredrelativeerrorfunction;and(d)LWE( , vick)= i vick,i( vick,i- i),aweightederrorfunction.TheL1metricprovidesnodistributional informationbecauseanycompleteallocationofsurplusisoptimal.12Thesefunctionsdo notrepresentanexhaustivesetofdistancemeasures.Forexample,onecouldalsoconsider themincombinationwithpre-selection,inwhichagentsaredroppedfromconsideration usinganinitialrule,andperhapsstochastically. WemightalsosubstituteanexpectedsurplusV forV andimplementaverage-case (orexante)budget-balance.AlthoughwedonotexploreexanteBBhere,itispossible thatthisweakerconstraintwillallowstrongerincentive-compatibilityproperties.13 4.2PaymentRules Ratherthansolvingproblem[PP]directly,wecancomputeananalyticexpressionforthe familyofsolutionsthatcorrespondtoeachdistancefunction.Eachfamilyofsolutionsisa parameterizedpaymentrule.ThepaymentrulesarepresentedinTable2.Weincludethe 11Wechoosetodesignforthetruth-revealingequilibrium,sothisisanappropriaterepresentationof(IR). Infact,thisisslightlypessimisticifagentsareexpectedtoshavetheiractualbidsinpractice. 12Dividebyzeroisavoidedinalldistancefunctionsbydroppingagentswith vick,i=0,andsimply setting i=0fortheseagents. 13Forexample,anextensiontotheGrovesmechanism,thedAGVA(or"expectedGroves")mechanism, duetoArrow[2]andd'AspremontandGerard-Varet[8],demonstratesthatitispossibletoachieve(EFF) andexante(BB)withinterim(IR),suchthatagentswillvountarilyparticipateiftheymustdecidebefore theyknowtheirownpreferences,inaBayesian-Nashincentive-compatiblemechanism. 25 Distance Name Definition Parameter Function Selection L2,L Threshold max(0, vick,i-C t) minCts.t.(BB') LRE Small vick,i,if vick,iC lminCls.t.(BB') 0otherwise L Reverse min( vick,i,C r) maxCrs.t.(BB') - No-Discount 0 - - Equal V
• http://wireless.fcc.gov/auctions/conferences/combin2001/papers/sandholm2.pdf
  • Å,GU equalstheGUofanotherbidset ¼¼ . Strictequalityconstraintsontradingvolume: 1.EQUAL-NET-REVENUE:EachbiddergetsequalNR. 2.EQUAL-GROSS-REVENUE:Eachbiddergetsequal GR. 3.EQUAL-NET-UNITS:EachbiddergetsequalNUona givensetofitemsż Å. 4.EQUAL-GROSS-UNITS:EachbiddergetsequalGUon agivensetofitemsż Å. Strictequalityconstraintsonacceptanceratio: 1.EQUAL-NET-REVENUE- ACCEPTANCE-RATIO:Everybiddergetsawardedthe sameratioofthenetrevenueofherbids(NR/NRasif allherbidsgotaccepted). 2.EQUAL-GROSS-REVENUE-ACCEPTANCE-RATIO: Everybiddergetsawardedthesameratioofthegross revenueofherbids(GR/GRasifallherbidsgotac- cepted). 3.EQUAL-NET-UNITS-ACCEPTANCE-RATIO: Ev- erybiddergetsawardedthesameratioofthenetunits ofherbids(NU/NUasifallherbidsgotaccepted)on agivensetofitemsż Å. 4.EQUAL-GROSS-UNITS-ACCEPTANCE-RATIO:Ev- erybiddergetsawardedthesameratioofthegrossunits ofherbids(GU/GUasifallherbidsgotaccepted)on agivensetofitemsż Å. Intheconstraintsabove,whenNR,GR,NU,andGUcom- parisonsaremade,theyaremadewithinthesametype(e.g., NUagainstNU).Thefollowingtheoremswouldapplytocon- straintswherecomparisonsaremadeacrossthesetypesas well(althoughwebelievethatsuchconstraintsarelesslikely tobeofrelevanceinpractice).Furthermore,theywouldap- plytoconstraintsonthedifferencebetweenthegrossandnet measures,aswellastoconstraintsontheratioofthegross andnetmeasures. Theorem4.1BCAWDP(andCRAWDP)withconstraints fromanyoftheclassespresentedinthissectionisÆÈ- complete(withandwithoutfreedisposal),evenwithinteger prices. PROOF.Byappropriatelypickingtheparametersforthe MAXandMINconstraints,theycanberelaxedsotheydonot constrainthesetoffeasibleallocations.BCAWDPwithsuch constraintsisthereforerichenoughtoemulateBCAWDPit- self,whichisÆÈ-complete. ToseethatBCAWDPwiththeequalityconstraintsisÆÈ- complete,consideraCAwithjustonebidder.Theequalities donotbind,buttheproblemstillisweightedsetpacking, whichisÆÈ-complete. ¾ Thesefourconstraintscansometimesbetoostronginthesense thataplayer'sownbidcanprecludetheacceptanceofsomeofher otherbidsbecauseherbidsshareitems. Theorem4.2CMUCEWDPwithconstraintsfromanyofthe classespresentedinthissectionispolytimesolvable(with andwithoutfreedisposal). PROOF.Eachconstraintfromanyoneoftheseclassescan bemodeledasonerow(constraint)thatisaddedtothelinear program(weskiptheseencodingsduetorestrictedspace,but theyarenotextremelyhardtoconstruct).Theresultinglinear programisthereforeofpolynomialsizeinthesizeofthein- put.Linearprogramscanbesolvedinpolynomialtimeinthe sizeofthelinearprogram(usinginteriorpointmethods).¾ 4.2SideConstraintsunderwhichtheContinuous andBinaryCaseAreHard Themostinterestingresultsofthispapershowthatsome classesofsideconstraintsthatareamongthemostimportant onesfromapracticalperspective,makeeventhecontinuous caseÆÈ-completetoclear. Theorem4.3Ifnomorethan winnersareallowed, BCAWDPandCCAWDP(aswellasBCRAWDPand CCRAWDP)areÆÈ-complete(withandwithoutfreedis- posal),evenifpricesareinteger. PROOF.ByTheorems2.2and2.3,eventhespecialcase wherethebidsareallonsingletonsisÆÈ-complete. ¾ Inacombinatorialauctionwherethebidsarecombined withOR,abiddercanonlyexpresscomplementarity,notsub- stitutability.Forexample,sayabidderhassubmittedthree bids: ½ ° , ¾ ° ,and ½ ¾ ° .Nowtheauction- eercanallocateitems1and2tothebidderfor$9.Toallow bidderstoexpressanyvaluationÚ ¾Å · ¼ ,itwas proposedthatbidderscansubmitXOR-constraintsbetween bids[9].IftwobidsarecombinedwithanXOR-constraint, onlyoneofthemcanwin. Itturnsoutthatinthecontin- uouscase,thereisaninherenttradeoffbetweenthefullex- pressivenessofXOR-constraintsandcomputationalcomplex- ity(recallthatinthebinarycase,CAWDPisÆÈ-complete evenwithoutXOR-constraints): Theorem4.4IfXOR-constraintsareallowedbetweenbids, BCAWDPandCCAWDP(aswellasBCRAWDPand CCRAWDP)areÆÈ-complete(withandwithoutfreedis- posal),evenifpricesareinteger. PROOF.ByTheorems2.4and2.5,eventhespecialcase wherethebidsareallonsingletonsisÆÈ-complete. ¾ Itfollowsthatwinnerdeterminationundertheotherfully expressivebiddinglanguagesthathavebeenproposedfor
• http://wireless.fcc.gov/auctions/conferences/combin2003/papers/masterevanjohn.pdf
  • assignment of spectrum rights......................................................................4 2.3 Exclusive licenses...........................................................................................................5 2.4 Proper definition of interference rights...........................................................................6 2.5 Special provisions for low-power devices......................................................................7 3 Elements of an Efficient Transition to Spectrum Markets......................................................8 3.1 Speed...............................................................................................................................9 3.2 Low transaction costs......................................................................................................9 3.3 Transparency...................................................................................................................9 3.4 Liquidity........................................................................................................................10 3.5 Participation..................................................................................................................10 3.6 Simultaneity..................................................................................................................11 3.7 Package Bidding...........................................................................................................14 4 A Proposed Transition Market Mechanism: Band-Restructuring Auctions........................16 4.1 Simultaneous two-sided auction with package bidding................................................16 4.2 Voluntary participation is the quid pro quo for flexibility............................................19 4.3 An incumbent need not sell its license..........................................................................21 4.4 Efficient and fair division of auction proceeds.............................................................22 4.5 FCC conducted band restructuring auctions................................................................23 5 What Spectrum Should be Restructured?.............................................................................24 5.1 300 MHz to 3000 MHz.................................................................................................25 5.2 Eliminating difficult bands from the initial implementation........................................26 Federal government spectrum...............................................................................................28 Core TV spectrum.................................................................................................................30 Unlicensed bands..................................................................................................................30 Non-exclusively
• http://wireless.fcc.gov/auctions/conferences/combin2003/papers/pdhetero-rakesh.pdf
  • (1986)constructanascendingauctionwhichresultsinVCG(equivalently, minimalWalrasian)payments.Inthisauction,biddersdeclarewhichobjects theypreferatcurrentprices,andpricesareincreasedon"overdemanded" setsofobjects-objectswhichareoutnumberedbythebidderswhorequire them. Incontrast,evenforthespecializedsettinginwhichallobjectsbeingsold areidentical(i.e.homogeneous),WalrasianpricesandVCGpaymentsneed notcoincide.Ausubel(2002)hasdesignedanascendingauctionwhichresults inVCGpaymentsforthiscase.Ontheotherhand,theascendingauction thatproducesminimalWalrasianpricesforthiscase(undertheassumption ofsincerebidding)isthewellknownuniform-priceauction. TobetterunderstandthedifferencesbetweentheVCGandWalrasian interpretations,itisusefultothinkofanascendingauctionasanalgorithm whichoptimizestheuseoftheauctioneer'sresources. ASystematicApproach Inlinearprogrammingproblems,thedualvariableofaconstraintrepresents theincreaseinvaluewhichcouldbeobtainedbyrelaxingthatconstraint.A bidder'sprofitinaVCGauctionistheincreasein"value"(oftheobjects) thatcanbeattributedtothatbidder'spresence.BikhchandaniandOstroy (2002)relatethesetwoobservationsbyformulatingtheefficient-assignment problemasalinearprogramwhosedualvariablesyieldthebidders'profits inaVCGauction(whenacertainconditionissatisfied). Wetakethisideaonestepfurtherbyinterpretingaprimal-dualalgorithm- usedtosolvesuchlinearprograms-asanascendingauctionfortheheteroge- 3 neousobjectcase,whenbiddersmayhavenon-additivevaluationfunctions. This"recipe"fordesigningauctions,brieflyoutlinedbyBikhchandanietal. (2002),isasfollows. 1.Formulatetheefficient-assignmentproblemasalinearprogram.By doingthisappropriately(al aBikhchandaniandOstroy,2002)dual variablescanbeinterpretedasthepaymentsmadebybiddersand/or thesurplustheyreceive. 2.Formulateaprimal-dualalgorithmforthislinearprogram. 3.Interpretthealgorithmasanauction. WeperformthefirststepinSection2.Thedualofourlinearprogram providesbidder-specificpricesforbundlesofobjects.InSection3weshow howtheprimal-dualalgorithmlendsitselftoanauctioninterpretation.In particular,itasksbidderstolistthebundlesofobjectstheydemandat currentprices,andthenadjuststhosepricesaccordingly.InSection4we discussthesituationsinwhichourgeneralizationoftheEnglishauctionin factimplementsVCGpayments. Itisnaturaltowonderwhetherthisrecipecanbeusedbyreplacing,in Step2,theprimal-dualalgorithmwithsomeotheriterativealgorithmused tosolvelinearprograms.Forexample,asubgradientalgorithmalsoworks byadjustingdualvariables;coulditalsoyieldanascendingauction?In Section5weshowthatasubgradientalgorithmforthisproblemcanbe interpretedastheauctiondescribedbyAusubelandMilgrom(2002). Moregenerally,ifoneexaminesthespecialcasesthathaveappearedin thepreviousliterature,itappearsthatmanyofthewell-knownascending auctionscanbederivedfromeitheraprimal-dualorsubgradientalgorithm. Table1categorizessuchauctions,wheretheunderlyingalgorithmoperates onoptimizationproblemswhosevariablescorrespondtoprices.3 Onedifferencebetweenthetwoalgorithmsistheinformationtheyuti- lizeateachiteration.Inauctionterms,aprimal-dualalgorithmrequiresa biddertoreporthisentiredemandcorrespondenceateachiteration,whilea 3NotableexceptionstothisparticularclassificationaretheworksofAusubel(2000)and ParkesandUngar(2002).Whilethoseworkscancertainlyberelatedtosuchalgorithms (e.g.thereisexplicituseofprimal-dualalgorithmsinthelatterpaper),theyoperatewith theuseofadditionalparameters(variables)which,inourview,cannotbeinterpretedas "ascendingprices."SeetheendofSection4.2. 4 Environment Primal-Dual Subgradient HeterogenousGoods, UnitDemand Demangeetal. (1986) CrawfordandKnoer(1981) HomogenousGoods, Diminishing MarginalUtility Ausubel(2002) Uniform-priceauction HeterogenousGoods, GrossSubstitutes GulandStacchetti (2000) KelsoandCrawford(1982) HeterogenousGoods, GeneralPreferences Thispaper Parkes(1999), AusubelandMilgrom(2002) Table1:Thisauctionliteraturecanbecategorizedbasedontheunderly- ingalgorithm. subgradientalgorithmrequiresthereportofonlyoneelementofthedemand correspondence.Thisisrelatedtoadifferenceinthewaytheyadjustvari- ables(i.e.prices);primal-dualalgorithmshaveadvantagesoversubgradient algorithmsintermsofconvergencespeed.Hencethereisatradeoffinthe meritsofthetwoalgorithms. 2TheEfficientAllocationProblem ThereisafinitesetofbiddersN,andafinitesetofindivisibleobjects(or goods),G.Eachbidderj Nhasanon-negativeintegervaluationforeach setofobjectsH Gdenotedvj(H) N0(withvj( )=0).Weassume thatv(·)isnon-decreasing,i.e.H H impliesvj(H) vj(H ).Preferences arequasi-linear:AbidderjwhoconsumesH Gandmakesapaymentof p Rreceivesanetpayoffofvj(H)-p. Thesetofobjectassignmentsisdenotedasfollows. = µ (2G)|N|:i =jimpliesµi µj= Anassignmentneednotallocateallobjects,sincewedonotrequire j Nµj= G.Assignmentµ isefficientifitisonethatmaximizes vj(µj).Effi-
• http://wireless.fcc.gov/auctions/data/bandplans/39band.pdf
  • FIXED (1999) MOBILE (1999) FIXED MOBILE Fixed (TLM) Land Mobile (TLM & TLC) Fixed (TLM) Land Mobile (TLM & TLC) MOBILE SA T. (Space to Earth) MARITIME MOBILE SA T. (Space to Earth) Mobile(Aero. TLM) MOBILE SA TELLITE (S-E) MOBILE SA TELLITE (Space to Earth) AERONAUTICAL MOBILE SA TELLITE (R) (space to Earth) 3.0 3.1 3.3 3.5 3.6 3.65 3.7 4.2 4.4 4.5 4.66 4.685 4.8 4.99 5.0 5.25 5.35 5.46 5.47 5.6 5.65 5.85 5.925 6.425 6.525 6.875 7.075 7.125 7.197.235 7.25 7.30 7.45 7.55 7.75 7.90 8.025 8.175 8.215 8.4 8.45 8.5 9.0 9.2 9.3 9.5 10.0 10.45 10.5 10.5510.6 10.68 10.7 11.7 12.2 12.7 12.75 13.2513.4 14.0 14.2 14.4 14.5 14.7145 15.1365 15.35 15.415.7 16.6 17.1 17.2 17.3
• http://wireless.fcc.gov/auctions/data/papersAndStudies/fc9775.pdf
  • plan to assess the competitiveness of the paging industry from this perspective. 4. Specialized Mobile Radio a. Overview The Commission created the SMR service in 1974 as a dispatch service to provide two- way voice communications between business vehicles, such as taxicabs and delivery trucks, and central dispatchers.166 Industry projections indicate that, by the year 2000, SMR services will reach 4.2 million customers, with 9 million customers in service by the year 2003.167 The SMR industry has continued to show healthy growth, with consistent double-digit growth rates. By the end of 1996, there were approximately 2.3 million vehicles and portable units served by SMR systems, a gain of 13 percent since the end of 1995.168 Although the monthly churn rate169 for
• http://wireless.fcc.gov/auctions/data/papersAndStudies/fc99136.pdf
  • telephone markets by broadband PCS and digital SMR operators has been accompanied by an increase in operators' churn levels. See Table 7 of Appendix B, which contains annual churn statistics for the four main publicly owned broadband PCS operators, a sample of cellular operators, and Nextel, the principal digital SMR operator.116 In 1998, broadband PCS operators had churn averaging approximately 4.2 percent, which was an increase from the 3.2 percent experienced in 1997. Some operators even experienced quarters with churn as high as 5.5 percent. While cellular operators have lower churn, usually at or below 2 percent,117 their churn levels have grown from 1.9 percent in 1996 to 2.0 percent in 1998. Historically, Nextel has kept its churn around 1.0 percent.
• http://wireless.fcc.gov/commoperators/Element%209.pdf
  • and the link will drop B. Idle characters will be sent.. C. The link will reverse. D. Synchronization will be lost. 9D34 (A) In SITOR Mode A, the time required to transmit a single group of data characters as measured using a calibrated oscilloscope with the horizontal timebase set to 50 ms/div would be indicated by a length of: A. 4.2 divisions. B. 4.8 divisions. C. 3.0 divisions. D. 3.0 centimeters. 9D35 (D) In a properly functioning MF/HF DSC system, the receiver bandwidth should be: A. Sufficiently wide to pass video pulses. B. 1.7 khz. C. As narrow as possible, but not less than 170 hz. D. 300 Hz maximum. 9D36 (B) A properly operating MF/HF DSC transmitter used in the
• http://wireless.fcc.gov/commoperators/element3.doc
  • Mixer blanking occurs. C. Spurious mixer products are generated. D. The mixer circuit becomes unstable and drifts. Answer Key: 3-44F1: B 3-44F2: D 3-44F3: A 3-44F4: C 3-44F5: B 3-44F6: C Key Topic 45: IF Amplifiers 3-45F1 What degree of selectivity is desirable in the IF circuitry of a wideband FM phone receiver? A. 1 kHz. B. 2.4 kHz. C. 4.2 kHz. D. 15 kHz. 3-45F2 Which one of these filters can be used in micro-miniature electronic circuits? A. High power transmitter cavity. B. Receiver SAW IF filter. C. Floppy disk controller. D. Internet DSL to telephone line filter. 3-45F3 A receiver selectivity of 2.4 kHz in the IF circuitry is optimum for what type of signals? A. CW. B. Double-sideband
• http://wireless.fcc.gov/outreach/2004broadbandforum/comments/KotzEssein.pdf
  • 200 250 Sep 30Oct 07Oct 14Oct 21Oct 28Nov 04Nov 11Nov 18Nov 25Dec 02Dec 09 Date (Sundays are labeled) Total Inbound Outbound Figure2:[SNMP]Dailytraffic(GB),distributionacrossdays. 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 0 50 100 150 200 250 Traffic (GB) Total Inbound Outbound Figure5displaysthevariationoftrafficoverthehoursoftheday. Thebarfor10AMisskewedabove11GBbythetrafficinWhit- temore;withoutWhittemore,the10AMbardropsslightlybelow thatofthe11AMbar.WhenweexaminedtheWhittemoretraffic, wesawadramaticburstofactivity,bothinboundandoutbound, everyMondayduringthe10AMhour,oftenaccountingfornearly 100%ofcampus-widetrafficduringthathour.Wedonothavedata todeterminetheapplicationcausingthetraffic,butwespeculate thatitisaregularlyscheduledactionsuchasbackuporsoftware update. Thetrafficissteadythroughouttheafternoonandeveningwith adiparounddinner,tailingoffthroughthenightwhenstudents finallygotosleep,andrisingagainasemployeesreturntowork. Becauseourenvironmentisamixtureofresidentialandacademic uses,thisplotshowsamixtureoftheworkdaybellcurveandthe residentialeveningbellcurve. 4.2Usersandusermobility Wedidnot(andcouldnot)trackusers,butsinceforthemost parteachcardisassociatedwithoneuser,andmostusershavejust onecard,weexaminedcardsasiftheyrepresentusers.Weask: ·Howmanycardsarethere?Fromwhichvendors? ·Howmanydaysiseachcardactive? ·HowmanyAPsdoesacardvisit? ·Howmanybuildingsdoesacardvisit? Therewere1706uniqueMACaddressesseeninoursyslogtrace, mostfromafewcommonvendors(Table1).Dartmouth'scampus Figure3:[SNMP]Dailytrafficpercard(GB). 0 0.01 0.02 0.03 0.04 0.05 0.06 0.07 0.08 Sep 30Oct 07Oct 14Oct 21Oct 28Nov 04Nov 11Nov 18Nov 25Dec 02Dec 09 Date (Sundays are labeled) Total Inbound Outbound Figure4:[SNMP]Averagedailytraffic(GB),byweekday. Mon Tue Wed Thu Fri Sat Sun 0 20 40 60 80 100 120 140 Inbound Outbound computingstoreresellsexclusivelyAppleandDellcomputers,and asof2001alllaptopssoldtofirst-yearstudentshavewirelesscards built-in:Agere(partofLucent)cardsintheDelllaptops,andAp- pleAirportcardsintheApplelaptops.ThestorealsosellsCisco
• http://wireless.fcc.gov/outreach/2004broadbandforum/comments/NewAmericaPublicKnowledge.pdf
  • particular area. Sometimes this is done by private groups sharing their own networks or promoting the concept of ubiquitous wireless connectivity. In other cases the access is funded by public organizations, non-profits, or corporations as a type of civic amenity. In all, the number of regular wireless LAN users is expected to grow sevenfold in the next four years, from 4.2 million to 31 million, according to the Gartner Group.43 Independent Community Access Points There are dozens of community WiFi organiza- tions in cities throughout the United States, and around the world. Typically, these groups are early users of WiFi technologies. They come together in physical meetings and through online discussions to share experiences, ask questions, and experiment with new technologies.
• http://wireless.fcc.gov/releases/da051650PublicUse.pdf
  • by Preference and Limitation (PURPL).....................24 3.4 Public Use Reservation by Departure Allocation (PURDA)............................25 3.5 Public Use Reservation with Queuing (PURQ)................................................26 3.6 Public Use Reservation with Queuing ­ All Calls (PURQ-AC).......................26 3.7 Allocation Percentage.......................................................................................27 3.8 Busy Period and Super Count...........................................................................28 3.9 Time Preference Algorithms (TPA)..................................................................28 3.10 PURAA (and PURQA).....................................................................................29 4. Network Modeling and Benefits...............................................................................30 4.1 Network Performance in "Hot Spot" Scenario.................................................30 4.2 Network Performance in Wide Scenario..........................................................31 4.3 End-to-End Performance..................................................................................32 5. Sensitivities...............................................................................................................33 5.1 Priorities............................................................................................................33 5.2 Queue Attributes...............................................................................................35 5.2.1 Maximum Number Calls Allowed in Queue............................................35 5.2.2 Maximum Allowed Time in Queue..........................................................36 5.2.3 Combination Size and Time......................................................................37 5.3 Cell Size............................................................................................................38 5.4 Random Access Control Channel.....................................................................40 5.5 GSM SDCCH....................................................................................................42 5.6 Directed Retry...................................................................................................45 5.7 Handovers.........................................................................................................47 5.8 Traffic Routing Mix..........................................................................................48 5.9 Emergency (911) Traffic...................................................................................49 6. Public Use
• http://wireless.fcc.gov/reports/documents/avatar-migratory-bird-report10104.pdf
  • Conclusions..........................................................................................................3-66 4. DATA NEEDS AND MITIGATION METHODS...............................................................4-1 4.1 GOING FORWARD AND DATA NEEDS.....................................................................4-1 4.1.1 Standardized Methods and Metrics........................................................................4-1 4.1.2 Species Differences and Susceptibility to Tower Collisions.................................4-2 4.1.3 Site Monitoring Approaches..................................................................................4-2 4.1.3.1 Radar..........................................................................................................4-2 4.1.3.2 Acoustics....................................................................................................4-3 4.1.3.3 Strike Indicators.........................................................................................4-3 4.1.3.4 Tower Site Studies.....................................................................................4-5 4.1.4 Study Biases...........................................................................................................4-5 4.1.5 Research on Avian Vision.....................................................................................4-6 4.1.6 Other Concepts, Approaches, and Recommendations...........................................4-7 4.1.7 Oversight and Research Organization...................................................................4-7 4.2 CURRENT STATE-OF-THE-ART MITIGATION METHODS AND APPROACHES4-8 4.2.1 Wire Marking.........................................................................................................4-8 4.2.1.1 Flapper.....................................................................................................4-10 4.2.1.2 BirdMARK Bird Flight Diverter..............................................................4-11 4.2.1.3 Bird Flight Diverter..................................................................................4-13 4.2.1.4 Swan Flight Diverter................................................................................4-14 4.2.1.5 Spiral Vibration Damper..........................................................................4-16 5. CONCLUSIONS AND RECOMMENDATIONS...............................................................5-1 6. REFERENCES.......................................................................................................................6-1 APPENDIX A REFERENCE REVIEW SHEETS Notice Of Inquiry Comment Review iv September 2004 Final LIST OF FIGURES Title Page Figure 3-1 Relative Altitudes of Migrating Birds
• http://wireless.fcc.gov/reports/documents/cmrscomp.pdf
  • plan to assess the competitiveness of the paging industry from this perspective. 4. Specialized Mobile Radio a. Overview The Commission created the SMR service in 1974 as a dispatch service to provide two- way voice communications between business vehicles, such as taxicabs and delivery trucks, and central dispatchers.166 Industry projections indicate that, by the year 2000, SMR services will reach 4.2 million customers, with 9 million customers in service by the year 2003.167 The SMR industry has continued to show healthy growth, with consistent double-digit growth rates. By the end of 1996, there were approximately 2.3 million vehicles and portable units served by SMR systems, a gain of 13 percent since the end of 1995.168 Although the monthly churn rate169 for
• http://wireless.fcc.gov/statements/CMRSDivisionslides.pdf
  • Year-End 2001 88% 81% 79% 68% 62% 55% 45% 11% 0% 20% 40% 60% 80% 100% Italy Finl and U.K. Ger man y Fran ce Japa n U.S. Chi na Sources: FCC (USA); Wireless 2002 ­ Focusing on Profitability, Global Equity Research, Goldman Sachs, May 3, 2002, at 4 (all other countries). International Comparisons: Total Subscribers: Year-End 2001 145.6128.5 69.156.250.94737 4.2 0 25 50 75 100 125 150 Chi na U.S. Jap an Ger man y Ital y U.K. Fran ce Fin land Millions Sources: FCC (USA); Wireless 2002 ­ Focusing on Profitability, Global Equity Research, Goldman Sachs, May 3, 2002, at 4 (all other countries).
• http://wireless.fcc.gov/uls/ebf/EBF_VEC_Users_Guide.doc
  • Content-Type: text/plain Content-Transfer-Encoding: 8bit Table of Contents 4. Response File 9 4.1. File Format 9 4.2. Record Types 9 5. Status and Error Codes 12 5.1. Status Codes 12 5.2. Error Codes 12 List of Tables Session Response 9 Application Response 10 Status Codes 12 List of Figures Figure 6 - Order of Record Types in Response File 9 Figure 7 - Sample RS Record 10 Figure 8 - Sample RA Record Where Application Is Granted
• http://wireless.fcc.gov/uls/releases/d001033f.pdf
  • band pointed within 2 degrees ( N )Yes No of the Geostationary Satellite Arc? *If >Yes=, attach waiver request explaining circumstances . Final Receiver 21) Receiver Location Name: GENESEO 22) Receiver antenna manufacturer: ELECTRONIX CO 23) Receiver antenna model number: DCB-74HDL 24) Call Sign: WFCC998 25) Height to Center of RX Antenna AGL (meters): 43.6 36) RX Antenna Beamwidth (degrees): 4.2 37) RX Antenna Gain (dBi): 33.1 28) Diversity RX Antenna Height AGL 29) Diversity RX Antenna Beamwidth 30) Diversity RX Antenna Gain (dBi): 31) RX Periscope Reflector Dimensions (meters): Height: Width: 32) RX Periscope Reflector Separation (meters): FCC 601 Schedule I August 1999 - Page 3 FCC Form 601 Schedule I Supplement 4 Frequency Data Transmitter Location Information 1) Transmit
• http://wireless.fcc.gov/weeklypn/2011/DOC-303907A1.pdf
  • RM WLT541 076-59-16.5 W 0004548853 NEW CINGULAR WIRELESS PCS, LLCDillsburg 12/28/2010 06375.14000 40-05-33.3 N TX RM WPJE823 097-08-24.9 W 0004549191 New Cingular Wireless PCS, LLC WACO 12/28/2010 06063.80000 31-39-53.7 N TX RM WPJE823 097-08-24.9 W 0004549191 New Cingular Wireless PCS, LLC WACO 12/28/2010 06740.00000 31-39-53.7 N TX RM WMN489 097-07-52.8 W 0004549227 New Cingular Wireless PCS, LLC WACO 12/28/2010 06315.84000 31-33-04.2 N TX RM WMN489 097-07-52.8 W 0004549227 New Cingular Wireless PCS, LLC WACO 12/28/2010 10755.00000 31-33-04.2 N PA RM WLV536 076-52-02.9 W 0004549344 NEW CINGULAR WIRELESS PCS, LLCNEW CUMBERLAN 12/28/2010 06315.84000 40-11-30.3 N PA RM WLV536 076-52-02.9 W 0004549344 NEW CINGULAR WIRELESS PCS, LLCNEW CUMBERLAN 12/28/2010 10975.00000 40-11-30.3 N TX RM WLL252 097-13-48.1 W 0004549359 New Cingular Wireless PCS, LLC
• http://wireless.fcc.gov/weeklypn/2011/DOC-304028A1.pdf
  • N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 06855.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11215.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11285.00000 55-32-29.6 N AK MD WQGD267 132-22-04.9 W 0004558882 AP&T Wireless, Inc. Kasaan 01/04/2011 11365.00000 55-32-29.6 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06063.80000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06152.75000 34-13-56.0 N CA MD WAJ88 117-14-04.2 W 0004558885 SOUTHERN CALIFORNIA EDISON COMTWIN LAKES 01/04/2011 06197.24000 34-13-56.0 N CA MD WPSQ228 117-29-42.2 W 0004558982 NEW CINGULAR WIRELESS PCS, LLCCamp Pendleton 01/04/2011 05945.20000 33-21-50.9 N CA MD WPSQ228
• http://wireless.fcc.gov/weeklypn/2011/DOC-304247A1.pdf
  • WPOR287 097-19-27.7 W 0004582055 U S D 259 WICHITA 01/21/2011 23475.00000 37-39-29.5 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 00953.05000 42-28-58.1 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 06585.00000 42-28-58.1 N IL MD WEF736 087-48-59.3 W 0004582089 UNION PACIFIC RAILROAD WINTHROP HARBO 01/21/2011 06635.00000 42-28-58.1 N NY NE 073-50-04.2 W 0004578723 CLEARWIRE SPECTRUM HOLDINGS IIINew York 01/19/2011 21825.00000 40-41-11.0 N NY NE 073-50-04.2 W 0004578723 CLEARWIRE SPECTRUM HOLDINGS IIINew York 01/19/2011 22025.00000 40-41-11.0 N PA NE 076-50-05.3 W 0004578733 Open Range Communications Dover 01/19/2011 23080.00000 39-58-56.3 N PA NE 076-47-55.3 W 0004578734 Open Range Communications Shiloh 01/19/2011 11305.00000 39-58-05.2 N PA NE 076-47-55.3 W 0004578734 Open Range Communications Shiloh
• http://wireless.fcc.gov/weeklypn/2011/DOC-304388A1.pdf
  • WI NE 091-49-01.7 W 0004584874 Illinois Central Railroad Company Solon Springs 01/24/2011 06034.15000 46-22-20.9 N WI NE 091-49-01.7 W 0004584874 Illinois Central Railroad Company Solon Springs 01/24/2011 06063.80000 46-22-20.9 N WI NE 090-33-50.8 W 0004584876 Illinois Central Railroad Company Owen 01/24/2011 06063.80000 44-57-06.2 N WI NE 090-33-50.8 W 0004584876 Illinois Central Railroad Company Owen 01/24/2011 06093.45000 44-57-06.2 N WI NE 088-31-04.2 W 0004584877 Illinois Central Railroad Company Oshkosh 01/24/2011 06197.24000 44-05-23.4 N WI NE 088-31-04.2 W 0004584877 Illinois Central Railroad Company Oshkosh 01/24/2011 06286.19000 44-05-23.4 N WI NE 090-24-13.8 W 0004584878 Illinois Central Railroad Company Riplinger 01/24/2011 06286.19000 44-49-28.2 N WI NE 090-24-13.8 W 0004584878 Illinois Central Railroad Company Riplinger 01/24/2011 06315.84000 44-49-28.2 N WI NE 091-21-09.1 W 0004584879 Illinois Central
• http://wireless.fcc.gov/weeklypn/2011/DOC-304911A1.pdf
  • Services Corp. WHITE MARSH 02/24/2011 11215.00000 39-23-43.0 N IN NE 087-23-58.8 W 0004629606 St. Francisville Properties, Inc. Terre Haute 02/24/2011 17865.00000 39-24-02.6 N NY NE 074-00-21.5 W 0004629727 Towerstream Corp. New York 02/24/2011 22075.00000 40-43-38.8 N NY NE 073-58-17.3 W 0004629728 Towerstream Corp. New York 02/24/2011 22075.00000 40-45-15.2 N NJ NE 074-06-04.7 W 0004629730 Towerstream Corp. New York 02/24/2011 11035.00000 40-49-04.2 N NY NE 073-59-30.8 W 0004629731 Towerstream Corp. New York 02/24/2011 21820.00000 40-44-19.6 N GA NE 084-17-54.0 W 0004629733 TOWER CLOUD, INC. Sandy Springs 02/24/2011 11425.00000 33-58-02.0 N GA NE 084-20-51.0 W 0004629734 TOWER CLOUD, INC. Sandy Springs 02/24/2011 10935.00000 33-58-09.0 N GA NE 084-19-47.3 W 0004629735 TOWER CLOUD, INC. Atlanta 02/24/2011 17965.00000 33-45-26.6 N GA NE 084-19-47.3 W 0004629735
• http://wireless.fcc.gov/weeklypn/2011/DOC-305045A1.pdf
  • 0004636145 Enbridge Energy Company, Inc. Jermyn 03/01/2011 06315.84000 33-15-55.8 N TX NE 098-09-43.0 W 0004636149 Enbridge Energy Company, Inc. JACKSBORO 03/01/2011 06226.89000 33-08-13.5 N Page 43 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 05945.20000 35-36-04.2 N TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 05974.85000 35-36-04.2 N TX NE 100-12-44.4 W 0004636151 Enbridge Energy Company, Inc. ALLISON 03/01/2011 06004.50000 35-36-04.2 N OK NE 099-50-35.0 W 0004636152 Enbridge Energy Company, Inc. SWEETWATER 03/01/2011 06197.24000 35-25-24.0 N TX NE 100-23-45.7 W 0004636153 Enbridge Energy Company, Inc. Wheeler 03/01/2011 06226.89000 35-27-53.0 N TX NE 100-23-33.2
• http://wireless.fcc.gov/weeklypn/2011/DOC-305322A1.pdf
  • Cooperative Tribune 03/16/2011 11285.00000 38-28-31.2 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00928.23125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00928.48125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00952.23125 48-21-50.7 N ND NE 103-02-32.0 W 0004655294 XTO Energy, Inc. Tioga 03/17/2011 00952.48125 48-21-50.7 N IN NE 087-11-04.2 W 0004655424 COMMUNITY FOUNDATION OF NW INDPortage 03/17/2011 11245.00000 41-33-35.3 N NE NE 098-04-03.8 W 0004655531 Superior iNET Superior 03/17/2011 10775.00000 40-07-31.9 N NE NE 097-58-15.6 W 0004655533 Superior iNET Edgar 03/17/2011 11265.00000 40-21-45.5 N NE NE 097-58-15.6 W 0004655533 Superior iNET Edgar 03/17/2011 11385.00000 40-21-45.5 N NE NE 097-50-33.0 W 0004655534 Superior iNET Sutton 03/17/2011 10895.00000 40-36-42.6 N TX
• http://wireless.fcc.gov/weeklypn/2011/DOC-305453A1.pdf
  • Wireless, Inc. Castor 03/22/2011 06226.89000 32-16-17.6 N NV NE 115-10-53.3 W 0004662566 New Cingular Wireless PCS, LLC LAS VEGAS 03/23/2011 10875.00000 35-56-55.6 N NY NE 074-00-21.5 W 0004662733 Towerstream Corp. New York 03/23/2011 22075.00000 40-43-38.8 N NY NE 073-58-17.3 W 0004662737 Towerstream Corp. New York 03/23/2011 22075.00000 40-45-15.2 N NJ NE 074-06-04.7 W 0004662738 Towerstream Corp. New York 03/23/2011 11035.00000 40-49-04.2 N NY NE 073-59-30.8 W 0004662739 Towerstream Corp. New York 03/23/2011 21820.00000 40-44-19.6 N CA NE 122-23-36.8 W 0004662740 Towerstream Corp. San Francisco 03/23/2011 22335.00000 37-47-44.7 N CA NE 122-24-06.4 W 0004662741 Towerstream Corp. San Francisco 03/23/2011 22235.00000 37-47-16.0 N CA NE 122-18-10.7 W 0004662742 Towerstream Corp. San Francisco 03/23/2011 17920.00000 37-46-55.5 N CA NE 122-23-51.7 W 0004662743 Towerstream Corp.
• http://wireless.fcc.gov/weeklypn/2011/DOC-305552A1.pdf
  • 0004644106 Thought Transmissions LLC Tallmadge 03/28/2011 06093.45000 41-05-48.0 N OH AM 081-28-27.6 W 0004644106 Thought Transmissions LLC Tallmadge 03/28/2011 06152.75000 41-05-48.0 N OH AM 081-39-25.0 W 0004644146 Thought Transmissions LLC Akron 03/28/2011 06345.49000 41-07-57.0 N OH AM 081-39-25.0 W 0004644146 Thought Transmissions LLC Akron 03/28/2011 06404.79000 41-07-57.0 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 02139.60000 36-48-04.2 N Page 41 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 06750.00000 36-48-04.2 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE DISTRICT ELECTRIC COMPANNEOSHO 03/29/2011 06835.00000 36-48-04.2 N MO AM WNTA379 094-16-45.8 W 0004651679 EMPIRE
• http://wireless.fcc.gov/weeklypn/2011/DOC-305954A1.pdf
  • MD KRH37 092-13-34.6 W 0004687449 BNSF Railway Co. BARING 04/12/2011 06635.00000 40-14-22.7 N MO MD KRH37 092-13-34.6 W 0004687449 BNSF Railway Co. BARING 04/12/2011 06695.00000 40-14-22.7 N MO MD KRH36 092-29-37.0 W 0004687451 BNSF Railway Co. LA PLATA 04/12/2011 06795.00000 40-01-42.9 N MO MD KRH36 092-29-37.0 W 0004687451 BNSF Railway Co. LA PLATA 04/12/2011 06855.00000 40-01-42.9 N MO MD KRH35 092-38-04.2 W 0004687464 BNSF Railway Co. ELMER 04/12/2011 06645.00000 39-51-08.2 N MO MD KRH35 092-38-04.2 W 0004687464 BNSF Railway Co. ELMER 04/12/2011 06695.00000 39-51-08.2 N MO MD WPUF488 092-57-15.1 W 0004687469 BNSF Railway Co. Marceline 04/12/2011 06775.00000 39-42-22.9 N MO MD WPUF488 092-57-15.1 W 0004687469 BNSF Railway Co. Marceline 04/12/2011 06805.00000 39-42-22.9 N MO MD KRH33 093-23-35.4 W 0004687474 BNSF Railway
• http://wireless.fcc.gov/weeklypn/2011/DOC-306105A1.pdf
  • W 0004699910 New Cingular Wireless PCS, LLC King City 04/21/2011 40-02-24.7 N MO MD KNKN553 094-51-37.8 W 0004699910 New Cingular Wireless PCS, LLC Maryville 04/21/2011 40-10-25.8 N MO MD KNKN553 094-53-06.4 W 0004699910 New Cingular Wireless PCS, LLC MARYVILLE 04/21/2011 40-22-00.1 N MO MD KNKN553 095-31-52.7 W 0004699910 New Cingular Wireless PCS, LLC Rockport 04/21/2011 40-24-27.1 N MO MD KNKN553 095-38-04.2 W 0004699910 New Cingular Wireless PCS, LLC Rockport 04/21/2011 40-34-13.4 N MO MD KNKN553 095-17-55.7 W 0004699910 New Cingular Wireless PCS, LLC TARKIO 04/21/2011 40-26-07.7 N KS MD KNKN553 095-02-21.0 W 0004699910 New Cingular Wireless PCS, LLC TROY 04/21/2011 39-47-34.0 N TX MD KNKA321 106-03-52.0 W 0004700448 Alltel Communications Southwest HoldingFabens 04/21/2011 31-33-47.9 N FL MD KNKN605 081-45-10.3 W 0004700573
• http://wireless.fcc.gov/weeklypn/2011/DOC-306296A1.pdf
  • HOLDINGS IIIDenver 04/25/2011 19625.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22025.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22225.00000 39-41-34.4 N CO MD WQMN378 105-01-35.8 W 0004703369 CLEARWIRE SPECTRUM HOLDINGS IIIDenver 04/25/2011 22375.00000 39-41-34.4 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10815.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10895.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 10935.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 11055.00000 39-41-04.2 N CO MD WQMP964 105-09-13.0 W 0004703372 CLEARWIRE SPECTRUM HOLDINGS IIILakewood 04/25/2011 11135.00000 39-41-04.2 N Page 33 MG
• http://wireless.fcc.gov/weeklypn/2011/DOC-306419A1.pdf
  • POWER COMCLOVER 05/02/2011 06152.75000 36-52-06.5 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA AM WNTR649 078-42-28.0 W 0004665166 VIRGINIA ELECTRIC AND POWER COMCLOVER 05/02/2011 06780.00000 36-52-06.5 N IL AM 088-56-34.0 W 0004687739 UNION PACIFIC RAILROAD COMPANYDIX 05/05/2011 06755.00000 38-25-30.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 11265.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 11385.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23025.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23175.00000 39-54-40.0 N OH AM 082-59-04.2 W 0004694994 CLEARWIRE SPECTRUM HOLDINGS IIIColumbus 05/03/2011 23325.00000
• http://wireless.fcc.gov/weeklypn/2011/DOC-306653A1.pdf
  • LLC SEWANEE 05/11/2011 11245.00000 35-14-55.9 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 06226.89000 36-01-04.7 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 11245.00000 36-01-04.7 N TN NE 087-20-32.2 W 0004724824 Conterra Ultra Broadband LLC DICKSON 05/11/2011 11325.00000 36-01-04.7 N TN NE 086-43-35.9 W 0004724825 Conterra Ultra Broadband LLC GREENBRIER 05/11/2011 10795.00000 36-26-04.2 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11245.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11285.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11325.00000 36-28-21.7 N TN NE 086-40-54.5 W 0004724826 Conterra Ultra Broadband LLC WHITE HOUSE 05/11/2011 11405.00000 36-28-21.7
• http://wireless.fcc.gov/weeklypn/2011/DOC-308228A1.pdf
  • KNKN570 093-15-15.2 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 06/29/2011 39-06-34.7 N MO MD KNKN570 093-11-14.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCMARSHALL 06/29/2011 39-08-44.9 N Page 23 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD KNKN570 093-57-28.5 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCOdessa 06/29/2011 39-01-04.2 N MO MD KNKN570 093-16-34.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCSEDALIA 06/29/2011 38-44-46.1 N MO MD KNKN570 093-37-59.1 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWARRENSBURG 06/29/2011 38-43-24.5 N MO MD KNKN570 093-30-39.0 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWaverly 06/29/2011 39-12-18.2 N MO MD KNKN570 093-37-27.2 W 0004785871 NEW CINGULAR WIRELESS PCS, LLCWAVERLY 06/29/2011 39-11-34.7 N NJ MD KNKA652
• http://www.fcc.gov/3G/3gfinalreport.doc http://www.fcc.gov/3G/3gfinalreport.pdf
  • 200 27 161 10 161 -10 161 Response Station 6000 CDMA 1250 27 161 10 161 -10 161 6000 CDMA 3750 27 161 10 161 -10 114 6000 W-CDMA 5000 27 161 10 161 -10 100 6000 TDMA 30 27 161 10 161 -10 161 6000 TDMA 200 27 161 10 161 -10 161 Similar to the analysis above, Table 4.2 tabulates the minimum spacing required to prevent interference between 3G base and mobile stations and first adjacent ITFS/MDS main and response station receivers. Table 4.2: Calculation of Adjacent Channel Separation Distances of 3G Stations to ITFS/MDS Stations ITFS/MDS System Parameters 3G System Parameters 3G Base Station (500 Watts) 3G Base Station (10 Watts) 3G Mobile Station (100 milliwatts) Protected Receiver
• http://www.fcc.gov/3G/3gfinalreportappendices.doc http://www.fcc.gov/3G/3gfinalreportappendices.pdf
  • will not occur beyond the radio horizon. The rules only require that an interference analysis be completed if the location of a proposed station is within 160.9 kilometers (100 miles) of an incumbent station. See 47 C.F.R. §§ 21.902 and 74.903. Therefore, any distance separation calculated beyond this limit is reduced to 160.9 kilometers (100 miles) in the table. APPENDIX 4.2 Feasibility Study on Spectrum Sharing between Fixed Terrestrial Wireless Services and proposed Third Generation Mobile Services in the 2500-2690 MHz Bands George W. Harter, Director of Broadcast Engineering, MSI for the Sprint Broadband Wireless Group, WorldCom Wireless Solutions, Nucentrix Broadband Networks, and the Wireless Communications Association International. (Used and reproduced with permission of the Wireless Communications Association International.) Abstract The
• http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.doc http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.pdf http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.txt
  • cable systems are held through three entities managed by Time Warner Cable: Time Warner Entertainment (``TWE''), Time Warner Entertainment - Advance/Newhouse Partnership (``TWE-A/N''), and TWI Cable, Inc. (``TWI Cable''). TWE is a limited partnership; Time Warner owns 74.5% of TWE. The remaining 25.5% is owned by AT&T as a result of its purchase of MediaOne Group, Inc. TWE serves approximately 4.2 million basic cable subscribers. TWI Cable, which serves approximately 1.8 million subscribers, is an indirect wholly-owned subsidiary of Time Warner. TWE-A/N is a general partnership owned by TWE, TWI Cable, and Advance/Newhouse Partnership. TWE-A/N serves approximately 6.7 cable million subscribers. Time Warner's partnership interest in TWE-A/N, held through TWE and TWI Cable, totals approximately 67%. Internet Services. Time Warner controls
• http://www.fcc.gov/Bureaus/Cable/Reports/fcc98335.pdf http://www.fcc.gov/Bureaus/Cable/Reports/fcc98335.txt
  • Independent Film Channel Sep-94 Cablevision (75) International Channel Jul-90 TCI (90) Kaleidoscope Sep-90 TCI (12) Knowledge TV (formerly Mind Extension University) Nov-87 Jones (97) MoreMAX (formerly Cinemax2) Aug-91 Time Warner (100) MuchMusic USA Jul-94 Cablevision (75) Odyssey Channel Oct-93 TCI (32.5) Outdoor Life Network Jul-95 Cox (33.3), TCI (16.7), Comcast (8.3), MediaOne (8.3) Ovation: The Arts Network Apr-96 Time Warner (4.2) Prevue Channel Jan-88 TCI (44) PIN (Product Information Network) Apr-94 Cox (45) QVC Nov-86 Comcast (57), TCI (43) Romance Classics Jan-97 Cablevision (75) Sci-Fi Channel Sept-92 TCI (18.6), MediaOne (<1) Sneak Prevue May-91 TCI (12) Speedvision Dec-95 Cox (33.3), TCI (16.7), Comcast (8.3), MediaOne (8.3) Federal Communications Commission FCC 98-335 D-4 Programming Service Launch Date MSO Ownership (%) Starz! Feb-94
• http://www.fcc.gov/Bureaus/Common_Carrier/Comments/access_reform/samples/MCICOM.htm
  • a year-over-year comparison, the incumbent LECs continue to increase local service and network access revenue significantly. Table VI-2. Revenue Growth[75]^(75) Percentage (%) Change Year-Over-Year 3Q95 v 3Q96 Network Local Access Service Revenue Revenue Ameritech 5.6 5.8 Bell Atlantic 3.3 5.2 Bell South 6.2 11.0 NYNEX 4.3 0.1 Pacific Tel 5.3 6.5 SBC 5.0 10.9 US West 2.3 9.3 GTE 8.0 4.2 Simple Average 5.0% 6.6% Furthermore, access lines continue to grow at an increasing rate as several RBOCs set records for lines added during 3Q96. The main growth driver continues to be the strong demand for second access lines.[76]^(76) As depicted in table VI-3 below, access line growth (year over year) averaged 4.6 percent in 3Q96 for the RBOCs and GTE,
• http://www.fcc.gov/Bureaus/Common_Carrier/News_Releases/1998/nrcc8060.pdf
  • 17.9 Mississippi N.A. N.A. N.A. N.A. N.A. N.A. 0.1 15.8 Missouri 10.4 11.3 11.2 12.2 12.3 12.9 15.8 11.0 Montana N.A. N.A. N.A. N.A. N.A. N.A. N.A. 15.8 Nebraska 43.1 43.1 40.6 39.4 37.0 33.6 30.4 25.3 Nevada N.A. N.A. N.A. 9.2 9.8 11.0 13.2 15.9 New Hampshire N.A. N.A. N.A. N.A. N.A. N.A. N.A. 25.6 New Jersey 3.2 3.8 4.2 4.6 4.9 6.5 7.0 9.1 New Mexico N.A. N.A. N.A. N.A. N.A. N.A. 12.6 6.2 New York 11.8 14.9 14.4 17.0 21.7 21.5 21.6 28.3 North Carolina 28.9 29.5 31.4 28.4 30.5 27.9 26.5 20.8 North Dakota N.A. N.A. N.A. N.A. N.A. 52.7 41.1 40.5 Ohio 9.8 10.4 10.7 10.2 9.9 9.6 9.6 8.1 Oklahoma N.A. N.A. N.A. N.A. 39.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1995/fcc95419.html
  • would put them to productive use. Footnote 36 A RespOrg initially pays the 70 cent "customer record administration" fee when it reserves a toll free number from the SMS database and continues to pay that fee when the number is in "assigned," "working," or "disconnect" status. See Bell Operating Companies' Tariff for the Service Management System, Tariff F.C.C. No. 1, 4.2(C). It is only when the number is returned to the spare pool or ported to another RespOrg that the original RespOrg ceases paying the administration fee. See supra para. 17 for a definition of "assigned," "working," and "disconnect" status. Footnote 37 PIN technology refers to the use of a personal identification number ("PIN") in conjunction with a toll free number.
• http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.txt http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.wp
  • assign initial codes to the extent required to terminate traffic.85 To obtain an initial code, the applicant must certify that a need exists due to routing, billing, regulatory or tariff requirements.86 Although applicants may be Federal Communications Commission FCC 99-122 __________________________________________________________________________________________________________________________________ 87 Id. at § 4.1. 88 Id. at § 4.1.4. 89 Id. at § 13.0. 90 Id. at § 4.2.1. The CO Code Assignment Certification Worksheet-TN Level (Months-to-Exhaust Worksheet), set forth in Appendix B to the CO Code Guidelines, requests data on telephone numbers available for assignment, growth history for the past six months, and projected demand for the coming 12 months. 91 See CO Code Guidelines at Appendix B n.1. 92 Jeopardy is defined as a situation where the
• http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.txt http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.wp
  • The PICC first took effect in January 1998. The Consumer Price Index (CPI) for interstate toll service dropped from 75.2 in December 1997 to 74.6 in December 1998, or 0.8 percent in absolute terms and 2.4 percent once adjusted for inflation. PHIL CHEILIK, FEDERAL COMMUNICATIONS COMMISSION, REFERENCE BOOK OF RATES, PRICE INDICES AND EXPENDITURES FOR TELEPHONE SERVICE Tbls. 4.1 & 4.2,at 68, 78 (June 1999). The CPI dropped another 4.1 points to 72.5 between December 1998 and May 1999, making the total decline 3.6 percent from December 1997, without adjusting for inflation. See BUREAU OF LABOR STATISTICS, CONSUMER PRICE INDEX-ALL URBAN CONSUMERS: INTERSTATE TOLL CALLS (Series ID: CUUR0000SS27051) (available at the Bureau of Labor Statistics web site, ). 6 10.The Commission
• http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99235.doc
  • transfer point port termination, switched direct trunk transport, signaling for switched direct trunk transport, entrance facilities for switched access traffic, tandem switched transport, the residual and service-related transport interconnection charges, information surcharge, and signaling for tandem switching) and all other interstate access not included in common line or switched access, charges by price cap ILECs, are unnecessary. Appendix A at 4.2. The signatory companies also agree, as part of the plan as a whole, not to initiate legal or regulatory action to adjust price cap determined rates for interstate access charges billed for access minutes prior to January 1, 2000, although a payee would not be precluded from accepting any refund the FCC ordered to be made and a payor will
• http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99345.doc http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99345.txt
  • a structural relationship between output per hours of all persons employed and private nonfarm business multifactor productivity using a double logarithmic (loge) transformation. Data for output per hour of all persons employed for 1998 is available from the Bureau of Labor Statistics and is used to generate the forecast. The results indicate that total factor productivity of LECs grew about 4.2 percent faster than productivity in the nonfarm private business sector of the economy over the 1986 to 1998 period. Calculation of Input Price Indexes The second component of the X-factor is the input price differential. This is just the value in the second set of parentheses in equation (26), %( IPUS(H) - %( IPLEC(H). Focus for now on the changes
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.txt http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.wp
  • capacity owners and do not assign a value to the remaining owners' market shares, given their minimal market presence. 325 See TAINO-CARIB C&MA at Schedule D at 3. 326 The eight largest owners of capacity account for 95.8 percent of the capacity on the route between the U.S. Virgin Islands and Puerto Rico. See id. The remaining owners account for 4.2 percent of the capacity, but none of these remaining owners holds one percent or more of the unassigned capacity. For purposes of calculating the HHI, we use the market shares of the eight largest capacity owners and do not assign a value to the remaining owners' market shares, given their minimal market presence. 327 Because WorldCom's ownership share of foreign
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc000j2.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc000j2.txt
  • boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment used for WDBD services including satellite and earth station equipment 4.23 - All other interexchange circuit equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.3 - Host/Remote Message Circuit Equipment Account
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.txt
  • § 4.4. Id. at § 4.1.3. An applicant may also obtain an initial NXX code in order to establish an initial Location Routing Number (LRN) per POI or switching entity for each Local Access and Transport Area (LATA), if the carrier has no existing resources available for LRN assignment. Id. at § 4.1.3.1. Id. at § 4.1. Id. at § 4.2.1. The CO Code Assignment Certification Worksheet-TN Level MTE Worksheet, set forth in Appendix B to the CO Code Assignment Guidelines, requests data on telephone numbers available for assignment, growth history for the past six months, and projected demand for the coming 12 months. See CO Code Assignment Guidelines at Appendix B n.1. Jeopardy is defined as a situation where the
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00208.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00208.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00208.txt
  • Commission expand Link Up assistance to cover all charges that an eligible telecommunications carrier may charge to establish service). See, e.g., Eastern Shoshone Tribe comments at 8 (in addition to ``switch activation fee'' of between $33.10-$52.00, carriers charge $375 Rural Network Assessment Tariff plus actual construction costs exceeding $2,300). See US West Communications, Exchange and Network Services Tariff, New Mexico, §§4.2.1, 5.2.4 (1999). See, e.g., Qualcomm comments at 3-4; Motorola/Iridium comments at 7. See Section III.D.2.a., supra, for a further discussion of these issues. See, e.g., Motorola/Iridium comments at 17. Review of Sections 68.104 and 68.213 of the Commission's Rules Concerning Connection of Simple Inside Wiring to the Telephone Network and Petition for Modification of Section 68.213 of the Commission's Rules
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.txt
  • Exchange Carrier (CLEC) Interface Change Management Process (dated Sept. 1, 1999) with SWBT Change Agreement (dated Sept. 23, 1999). SWBT's Change Agreement sets forth a timeline for changes to existing interfaces and the introduction of new interfaces. See Change Agreement §§ 3.3.1-3.3.16 (timeline for changes to existing application-to-application interfaces); id. §§ 3.5.1-3.5.10 (timeline for changes to graphical-user interfaces); id. §§ 4.2.1-4.2.18 (timeline for the introduction of new application-to-application interfaces); id. §§ 4.3.1-4.3.12 (timeline for the introduction of new graphical-user interfaces). Changes are divided into two different categories: ``Category One,'' which refers to changes to application-to-application interfaces; and ``Category Two,'' which refers to changes to graphical-user or proprietary interfaces. The Change Agreement specifies the timelines associated with each type of change. In
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00306.pdf
  • WORK EQ 5.6 0 48.1 9.3 2121 BUILDINGS 27.0 0 22.4 2.9 2122 FURNITURE 5.2 5 46.6 9.3 2123.1 OFFICE SUPPORT EQ 3.5 0 6.8 26.6 2123.2 COMPANY COMMUN EQ 4.6 0 66.4 7.3 2124 GEN'L PURPOSE COMPUTERS 2.7 0 93.8 2.3 2212 DIGITAL ELECTRONIC SW 7.0 0 39.3 8.7 2220 OPERATOR SYSTEMS 4.9 0 39.7 12.3 2231 RADIO SYSTEMS 4.2 0 51.1 11.6 2232 CIRCUIT EQ 5.8 0 40.7 10.2 2362 OTHER TERMINAL EQ 2.2 0 62.3 17.1 2411 POLES 13.3 -97 73.2 9.3 2421 AERIAL CABLE METALLIC 10.2 -17 66.0 5.0 2421 AERIAL CABLE NONMETAL 13.9 -10 38.9 5.1 2422 UG CABLE METALLIC 14.1 -22 47.9 5.3 2422 UG CABLE NONMETAL 13.8 -10 31.2 5.7 2423 BURIED CABLE METALLIC
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01029.txt
  • trouble report rates of 15.3 percent, 15.9 percent, and 17 percent for the same period. SWBT's Oklahoma performance is reported as 14.3 percent, which is just above the 12 percent benchmark. See SWBT Aggregated Performance Data (Kansas), Measure No. 69-03 (``Repeat Reports - BRI Loop''), at 271-No. 69a. SWBT's trouble report rates for DSL loops provided to competing carriers were 4.2 percent, 1.7 percent, 2.0 percent, and 3.1 percent for the months of July, August, September, and October 2000 respectively. See SWBT Aggregated Performance Data (Kansas), Measure No. 65-08 (``Trouble Report Rate - DSL - No Line Sharing''), at 271-No. 65c; see also SWBT Reply at 64. See SWBT Aggregated Performance Data (Oklahoma), Measure No. 65-08 (``Trouble Report Rate - DSL
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01130.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01130.txt
  • interconnection the BOC provided to its own retail operations. See SWBT Texas Order, 15 FCC Rcd at 18380, para. 62. See Massachusetts Department Massachusetts I Comments at 20; D.T.E. Tariff No. 17. See Verizon Massachusetts I Lacouture/Ruesterholz Decl. at para. 8; see also Verizon Massachusetts II Application App. B, Vol. 1, Tab 1A at 18; CLEC Handbook, Vol. III, § 4.2.3.2. See Verizon Massachusetts II Lacouture/Ruesterholz Decl. at paras. 37-38, 187; Verizon Massachusetts II Application App. B, Vol. 1, Tab 2. Verizon has implemented a number of performance measures relating to interconnection, including measures that compare blockage on Verizon common trunk groups with blockage on dedicated trunk groups serving competitive LECs (NP 1-01); measures that capture missed appointments for trunk installations
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01162.doc http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01162.txt
  • boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment used for WDBD services including satellite and earth station equipment 4.23 - All other interexchange circuit equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.3 - Host/Remote Message Circuit Equipment Account
• http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2002/fcc02331.pdf
  • be changes in the metric definition, or changes in the retail analog applied, making it difficult to compare data over time. Metric SQM No.Metric Name Metric SQM No.Metric Name RESALE A.3.5 M&R-5Out of Service > 24 hours Ordering Billing A.1.1 O-7 % Rejected Service Requests ­ Mech. A.4.1 B-1 Invoice Accuracy A.1.2 O-7 % Rejected Service Requests - Partially Mech. A.4.2 B-2 Mean Time to Deliver Invoices ­ CRIS A.1.3 O-7 % Rejected Service Requests - Non-Mech. UNBUNDLED NETWORK ELEMENTS A.1.4 O-8 Reject Interval ­ Mech. Ordering A.1.7 O-8 Reject Interval - Partially Mech. ­ 10 hours B.1.1 O-7/O-13% Rejected Service Requests ­ Mech. A.1.8 O-8 Reject Interval - Non-Mech. B.1.2 O-7/O-13% Rejected Service Requests - Partially Mech. A.1.9 O-9 FOC
• http://www.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.html http://www.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.pdf http://www.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.txt http://www.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.wp
  • were submitted after USAC submitted its May 1st filing. USAC reported in its May 1st filing that, because several carriers had not yet submitted their Universal Service Worksheet, approximately 18 percent of the end-user telecommunications revenues were based on estimates by USAC. According to USAC, the percent of industry revenues that continues to be based on estimates by USAC is 4.2 percent. Id. 14. Letter from Lisa Rosenblum, USAC, to Magalie Roman Salas, FCC, dated March 18, 1998 (USAC March 18 letter). See also Letter from Robert Haga, USAC, to Magalie Roman Salas, FCC, dated June 12, 1998 (USAC June 12 letter). 15. See USAC June 12 letter. 16. See USAC May 14 letter. 17. 47 C.F.R. 54.709(a)(4). References 1. http://transition.fcc.gov/Bureaus/Common_Carrier/Public_Notices/1998/da981130.txt
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0603.pdf
  • and large business, institutional, and government customers. Number of Providers Zero 40.3% 33.0% 26.8%22.2%20.6%16.1% 12.0% One 26.0 25.9 22.7 20.3 19.3 18.4 17.3 Two 15.5 17.8 18.4 16.7 15.7 16.2 16.8 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 8.0 Dec 2002 Dec 2001 Jun 2002 Table 12 Percentage of Zip Codes with High-Speed Lines in Service Dec 1999 Jun 2000 Dec 2000 Jun
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0604.pdf
  • 40.3% 33.0% 26.8%22.2%20.6%16.1%12.0% 9.0% 6.8% One 26.0 25.9 22.7 20.3 19.3 18.4 17.3 16.4 14.9 Two 15.5 17.8 18.4 16.7 15.7 16.2 16.8 16.9 17.1 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 14.0 14.9 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 10.6 11.2 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 7.7 7.8 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 5.3 5.8 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 4.0 4.2 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 3.1 3.3 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 2.5 2.6 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 8.0 10.5 11.4 Chart 10 Percent of Zip Codes with High-Speed Providers 1 Table 12 Percentage of
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0702.pdf
  • in at Least One Direction) 1/ Other includes medium and large business, institutional, and government customers. Number of Providers Zero 40.3% 33.0% 26.8% 22.2% 20.6% One 26.0 25.9 22.7 20.3 19.3 Two 15.5 17.8 18.4 16.7 15.7 Three 8.2 9.2 10.9 13.2 13.1 Four 4.3 4.9 6.1 8.2 9.1 Five 2.7 3.4 4.0 4.9 6.1 Six 1.7 2.5 3.0 3.6 4.2 Seven 0.8 1.7 2.3 2.8 3.2 Eight 0.3 0.8 2.0 2.2 2.5 Nine 0.2 0.4 1.6 1.9 2.0 Ten or More 0.0 0.4 2.4 3.9 4.0 Table 9 Percentage of Zip Codes with High-Speed Lines in Service December 1999 June 2000 December 2000 June 2001 December 2001 High-Speed Providers by Zip Code Number of Reporting Providers 7 or more 4
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0705.pdf
  • 19.3 18.4 17.3 16.4 14.9 13.8 12.5 Two 15.5 17.8 18.4 16.7 15.7 16.2 16.8 16.9 17.1 16.8 16.3 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 14.0 14.9 14.9 15.1 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 10.6 11.2 11.6 12.2 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 7.7 7.8 8.4 8.9 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 5.3 5.8 6.1 6.3 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 4.0 4.2 4.4 4.6 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 3.1 3.3 3.6 3.6 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 2.5 2.6 2.8 3.1 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 8.0 10.5 11.4 11.8 12.8 Note: Figures may not
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0801.pdf
  • 7,106,229 * Data witheld to maintain firm confidentiality. High-Speed Lines by Type of User Table 7 (Over 200 kbps in at Least One Direction) 1/ Other includes medium and large business, institutional, and government customers. Number of Providers Zero 44.0% 30.1% 25.0% One 24.5 25.8 24.5 Two 14.2 16.7 18.6 Three 8.1 9.3 10.7 Four 4.4 6.0 6.2 Five 2.6 4.2 4.1 Six 1.5 3.1 3.0 Seven 0.6 2.2 2.3 Eight 0.2 1.2 2.0 Nine 0.0 0.6 1.6 Ten or More 0.0 0.9 2.1 * Data for June 2000 have been revised. December 1999 June 2000* December 2000 Table 8 Percentage of Zip Codes with High-Speed Lines in Service High-Speed Providers by Zip Code Number of Reporting Providers 7 or more
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd1202.pdf
  • Other includes medium and large business, institutional, and government customers. Number of Providers Zero 40.3% 33.0% 26.8% 22.2% 20.6% 16.1% One 26.0 25.9 22.7 20.3 19.3 18.4 Two 15.5 17.8 18.4 16.7 15.7 16.2 Three 8.2 9.2 10.9 13.2 13.1 13.3 Four 4.3 4.9 6.1 8.2 9.1 9.6 Five 2.7 3.4 4.0 4.9 6.1 6.9 Six 1.7 2.5 3.0 3.6 4.2 4.6 Seven 0.8 1.7 2.3 2.8 3.2 3.2 Eight 0.3 0.8 2.0 2.2 2.5 2.8 Nine 0.2 0.4 1.6 1.9 2.0 2.4 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 Table 9 Percentage of Zip Codes with High-Speed Lines in Service December 1999 June 2000 December 2000 June 2001 June 2002 December 2001 High-Speed Providers by Zip Code Number
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd1203.pdf
  • government customers. Number of Providers Zero 40.3% 33.0% 26.8%22.2%20.6%16.1%12.0% 9.0% One 26.0 25.9 22.7 20.3 19.3 18.4 17.3 16.4 Two 15.5 17.8 18.4 16.7 15.7 16.2 16.8 16.9 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 14.0 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 10.6 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 7.7 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 5.3 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 4.0 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 3.1 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 2.5 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 8.0 10.5 Jun 2003 Dec 2001 Jun 2002 Dec 2002 Table 12 Percentage of Zip Codes with High-Speed Lines in Service
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd1204.pdf
  • One 26.0 25.9 22.7 20.3 19.3 18.4 17.3 16.4 14.9 13.8 Two 15.5 17.8 18.4 16.7 15.7 16.2 16.8 16.9 17.1 16.8 Three 8.2 9.2 10.9 13.2 13.1 13.3 14.4 14.0 14.9 14.9 Four 4.3 4.9 6.1 8.2 9.1 9.6 10.3 10.6 11.2 11.6 Five 2.7 3.4 4.0 4.9 6.1 6.9 7.3 7.7 7.8 8.4 Six 1.7 2.5 3.0 3.6 4.2 4.6 5.0 5.3 5.8 6.1 Seven 0.8 1.7 2.3 2.8 3.2 3.2 3.9 4.0 4.2 4.4 Eight 0.3 0.8 2.0 2.2 2.5 2.8 2.7 3.1 3.3 3.6 Nine 0.2 0.4 1.6 1.9 2.0 2.4 2.2 2.5 2.6 2.8 Ten or More 0.0 0.4 2.4 3.9 4.0 6.4 8.0 10.5 11.4 11.8 Note: Figures may not add up to 100% due
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd1208_tables.doc
  • 5,616 13,035 8,103 10,877 10,915 13,533 21,317 10,325 86 75, 154 88,190 Percentages aDSL 4.1 8.9 13.0 7.1 20.6 29.9 26.6 2.4 0.4 0.0 87.0 100.0 sDSL 0.0 0.0 0.0 49.6 29.6 * 1.2 0.0 * 0.0 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.8 48.5 19.8 3.4 18.9 0.6 0.0 100.0 100.0 Cable Modem 1.0 1.4 2.5 0.8 2.9 4.2 14.6 53.4 21.5 0.2 97.5 100.0 FTTP 0.1 0.0 0.2 0.5 1.1 2.0 25.0 1.3 69.4 0.6 99.8 100.0 Satellite 56.1 32.2 88.3 * * * * 0.0 0.0 0.0 11.7 100.0 Fixed Wireless 14.1 4.8 18.9 21.2 22.5 25.2 8.7 1.7 1.8 0.1 81.1 100.0 Mobile Wireless 28.8 13.0 41.8 30.1 21.5 6.0 0.6 0.0 0.0 0.0 58.2 100.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias0610_tables.doc
  • 60% Greater than 60 and no more than 80% Greater than 80 and no more than 100% 100% or more aDSL 6.1 10.7 10.2 25.0 20.1 12.9 7.1 3.5 2.6 0.8 1.0 sDSL 94.5 5.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Other Wireline 99.1 0.7 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Cable Modem 6.3 4.2 4.6 13.9 17.2 16.5 14.1 9.9 8.9 2.6 1.8 FTTP 81.8 7.5 1.7 2.5 1.9 1.5 1.2 0.8 0.7 0.2 0.2 Satellite 46.0 49.2 3.6 1.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 86.0 11.1 1.5 1.0 0.3 0.1 0.0 0.0 0.0 0.0 0.0 Power Line 99.9 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 All
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias0611_tables.doc
  • than 6 mbps At least 6 mbps Total Less than 768 kbps 18,969 7,771 6,990 33,730 At least 768 kbps & Less than 1.5 mbps 3,667 5,652 12,955 22,273 At least 1.5 mbps 595 361 29,609 30,565 Total 23,231 13,784 49,554 86,568 Percentages Less than 768 kbps 21.9 9.0 8.1 39.0 At least 768 kbps & Less than 1.5 mbps 4.2 6.5 15.0 25.7 At least 1.5 mbps 0.7 0.4 34.2 35.3 Total 26.8 15.9 57.2 100.0 Note: Figures may not sum to totals due to rounding. Source: FCC Form 477, Part I. Residential Connections over 200 kbps in at Least One Direction (in thousands) Downstream Speed Upstream Speed Less than 3 mbps At least 3 mbps and less than 6
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias1210_tables.doc
  • more than 80% Greater than 80 and no more than 100% 100% or more aDSL 0.6 2.2 6.6 29.1 28.6 19.4 8.8 2.8 1.2 0.2 0.5 sDSL 83.2 15.7 0.7 0.1 0.3 0.0 0.0 0.0 0.0 0.0 0.0 Other Wireline 94.7 5.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Cable Modem 14.1 10.1 10.4 19.0 17.9 13.4 8.8 4.2 1.8 0.1 0.0 FTTP 63.7 26.5 3.4 2.8 1.8 1.0 0.6 0.2 0.2 0.0 0.0 Satellite 0.8 86.5 10.5 2.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 50.1 39.8 6.0 3.3 0.6 0.2 0.1 0.0 0.0 0.0 0.0 Power Line 99.5 0.5 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 All Other 99.8 0.2 0.0 0.0 0.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ilec-ld.pdf
  • 17.9 Mississippi N.A. N.A. N.A. N.A. N.A. N.A. 0.1 15.8 Missouri 10.4 11.3 11.2 12.2 12.3 12.9 15.8 11.0 Montana N.A. N.A. N.A. N.A. N.A. N.A. N.A. 15.8 Nebraska 43.1 43.1 40.6 39.4 37.0 33.6 30.4 25.3 Nevada N.A. N.A. N.A. 9.2 9.8 11.0 13.2 15.9 New Hampshire N.A. N.A. N.A. N.A. N.A. N.A. N.A. 25.6 New Jersey 3.2 3.8 4.2 4.6 4.9 6.5 7.0 9.1 New Mexico N.A. N.A. N.A. N.A. N.A. N.A. 12.6 6.2 New York 11.8 14.9 14.4 17.0 21.7 21.5 21.6 28.3 North Carolina 28.9 29.5 31.4 28.4 30.5 27.9 26.5 20.8 North Dakota N.A. N.A. N.A. N.A. N.A. 52.7 41.1 40.5 Ohio 9.8 10.4 10.7 10.2 9.9 9.6 9.6 8.1 Oklahoma N.A. N.A. N.A. N.A. 39.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0603.pdf
  • 5.5 6.1 6.3 4.0 4.5 5.2 3.0 3.8 4.4 2.3 2.9 3.5 1.7 2.2 2.9 1.4 2.1 2.6 3.7 5.9 7.3 Households Percentage 12,210,584 11.8% 8.8% 5.8% 10,966,988 10.6 8.5 8.2 10,963,681 10.6 9.7 8.3 12,043,438 11.6 10.8 7.0 11,641,715 11.3 9.7 8.3 9,661,002 9.3 8.8 8.4 7,469,060 7.2 8.0 8.4 6,357,600 6.1 6.7 7.6 5,036,094 4.9 5.3 7.0 4,374,933 4.2 5.3 7.0 12,653,572 12.2 18.3 23.9 Source: Demographic Power Pack, Current Year Update (2000), MapInfo Corporation. 2 3 4 5 Table 15 Households in Zip Codes with Competitive Local Exchange Carriers 7,271,594 8,705,708 8,677,027 7,879,537 7,250,548 5,519,918 9,055,400 8,242,468 18,914,169 Households 9,110,776 5,984,632 Percentage 8,519,360 8,539,266 7,249,781 24,735,749 10,076,447 Table 14 Percentage of Zip Codes with Competitive Local Exchange Carriers
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0604.pdf
  • 23% of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 16% more unbundled network element (UNE) loops with switching to unaffiliated carriers at the end of December 2003 than they reported six months earlier (15.2 million compared to 13.0 million) and about 1% more UNE loops without switching (about 4.3 million compared to 4.2 million). At least one CLEC was serving local telephone service end-user customers in 75% of the nation's zip codes at the end of December 2003, up from 69% a year earlier. About 96% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico. As additional information becomes
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0702.pdf
  • 5.5 6.1 5 4.0 4.5 6 3.0 3.8 7 2.3 2.9 8 1.7 2.2 9 1.4 2.1 10 or More 3.7 5.9 1/ Data for December 2000 have been revised. Households Percentage 12,210,584 11.8% 8.8% 10,966,988 10.6 8.5 10,963,681 10.6 9.7 12,043,438 11.6 10.8 11,641,715 11.3 9.7 9,661,002 9.3 8.8 7,469,060 7.2 8.0 6,357,600 6.1 6.7 5,036,094 4.9 5.3 4,374,933 4.2 5.3 10 3,723,246 3.6 5.1 11 2,746,611 2.7 4.2 12 1,887,753 1.8 2.8 13 1,261,606 1.2 1.7 14 926,620 0.9 1.1 15 695,625 0.7 0.9 16 501,645 0.5 0.5 17 368,193 0.4 0.5 18 182,488 0.2 0.4 > 18 359,785 0.3 1.1 1/ Data for December 2000 have been revised. Source: Demographic Power Pack, Current Year Update (2000), MapInfo Corporation.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0705.pdf
  • carriers or used unbundled network element (UNE) loops that they leased from other carriers. ILECs reported providing about 3% fewer UNE loops with switching (referred to as the UNE-Platform) to unaffiliated carriers at the end of December 2004 than they reported six months earlier (16.5 million compared to 17.1 million) and also about 3% fewer UNE loops without switching (about 4.2 million). As additional information becomes available, it will be posted on the Commission's Internet site. The report is available for reference in the FCC's Reference Information Center, Courtyard Level, 445 12th Street, SW, Washington, DC. Copies may be purchased by calling Best Copy and Printing, Inc. at (800) 378­3160. The report can also be downloaded from the FCC-State Link Internet
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1200.pdf
  • 309,263 0.3 1,201 0.26 New Jersey 5 2,750,024 3.0 8,143 0.34 New Mexico 4 395,111 0.4 1,740 0.23 New York 8 5,016,524 5.5 18,197 0.28 North Carolina 9 2,730,178 3.0 7,651 0.36 North Dakota * * * 634 * Ohio 13 3,278,960 3.6 11,257 0.29 Oklahoma 11 979,513 1.1 3,358 0.29 Oregon 8 1,082,425 1.2 3,316 0.33 Pennsylvania 12 3,850,372 4.2 11,994 0.32 Puerto Rico 4 1,090,005 1.2 3,890 0.28 Rhode Island 6 313,550 0.3 991 0.32 South Carolina 6 1,236,338 1.4 3,886 0.32 South Dakota * * * 733 * Tennessee 12 1,876,444 2.1 5,484 0.34 Texas 21 6,705,423 7.4 20,044 0.33 Utah 8 692,006 0.8 2,130 0.32 Vermont * * * 594 * Virgin Islands 0 0 0 121
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1203.pdf
  • from other carriers. The remainder of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 27% more unbundled network element (UNE) loops with switching to unaffiliated carriers at the end of June 2003 than they reported six months earlier (13.0 million compared to 10.2 million) and about 1% fewer UNE loops without switching (about 4.2 million compared to 4.3 million). At least one CLEC was serving local telephone service end-user customers in 73% of the nation's zip codes at the end of June 2003, up from 67% a year earlier. About 95% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1204.pdf
  • 11.6 11.5 10.8 9.5 7.0 5.4 5.7 4.9 Four 11.1 11.3 10.1 9.7 10.3 8.3 6.0 5.5 5.6 Five 9.6 9.3 8.7 8.8 9.0 8.4 6.8 5.7 5.7 Six 6.4 7.2 7.6 8.0 8.4 8.4 7.1 6.9 7.0 Seven 4.3 6.1 6.0 6.7 7.6 7.6 7.9 6.7 8.1 Eight 3.7 4.9 5.6 5.3 6.0 7.0 8.0 7.4 9.8 Nine 3.7 4.2 4.5 5.3 4.6 7.0 7.2 7.0 8.4 Ten or More 8.9 12.2 18.8 18.3 19.7 23.9 34.6 39.5 37.9 Source: Demographic Power Pack, Current Year Update (2000), MapInfo Corporation Note: Figures may not add to 100% due to rounding. Jun Jun 2004 2004 Percentage of Households in Zip Codes with Competitive Local Exchange Carriers Table 15 Number of CLECs 2000
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp98.pdf
  • Served by Switching Centers Where New Entrants Have Collocation Arrangements (Residential Lines and Other Lines).......................................38 i IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA........................................41 Table 4.1Nationwide Information: Local Service Competitors Receiving First, Relinquishing Last, and Holding Numbering Codes by Type of Market........................................44 Chart 4.1Nationwide Information: Local Service Competitors Holding Numbering Codes by Type of Market........................44 Table 4.2Nationwide Information: Percentage of Markets with One or More Local Service Competitors Holding Numbering Codes.............45 Chart 4.2Nationwide Information: Percentage of Markets with One or More Local Service Competitors Holding Numbering Codes.............45 Table 4.3Nationwide Information: Numbering Codes Assigned to Local Exchange Carriers......................................46 Chart 4.3Nationwide Information: Numbering Codes Issued to Local Exchange Carriers......................................46 Chart 4.4State Information: Date First Local Service Competitor Received a
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp99-1.pdf
  • Lines....................................28 Table 3.3Lines Provided by Large ILECs to CLECs as UNE Loops...................32 Table 3.4Percent of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements...............................36 IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA..............................................43 Table 4.1Local Service Competitors Holding Numbering Codes.....................45 Chart 4.1Local Service Competitors Holding Numbering Codes by LATA on July 1, 1999................................................46 Table 4.2Local Service Competitors Identified..................................47 Table 4.3Numbering Codes Assigned to Local Exchange Carriers....................66 V. TELEPHONE NUMBERS TRANSFERRED AMONG CARRIERS....................67 Table 5.1Telephone Numbers Transferred.....................................69 VI.NEW ENTRANT LOCATOR INFORMATION .................................71 Table 6.1Competitive Access Providers and Competitive Local Exchange Carriers ..............................................73 Table 6.2Local Resellers and Other Local Exchange Carriers.......................81 Table 6.3Long Distance Carriers Reporting Local Revenues........................83 VII.ADDITIONAL INFORMATION SOURCES: LOCAL COMPETITION BY STATE...........................................................85 CONTACTING THE
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ldrpt101.pdf
  • 463 Arkansas 60.8 9.6 6.0 23.6 250 California 61.3 18.5 5.4 14.7 2,326 Colorado 61.1 17.4 5.4 16.0 350 Connecticut 33.0 20.2 3.9 42.9 203 Delaware 65.1 20.5 3.6 10.8 83 District of Columbia 46.8 21.3 10.6 21.3 47 Florida 60.5 16.5 10.3 12.7 1,426 Georgia 66.2 16.1 3.7 14.0 542 Idaho 55.5 15.1 5.0 24.4 119 Illinois 70.5 13.7 4.2 11.6 1,012 Indiana 60.1 15.4 7.8 16.7 604 Iowa 54.4 21.3 3.8 20.5 371 Kansas 65.1 4.1 12.9 17.8 241 Kentucky 59.8 18.6 2.7 18.9 366 Louisiana 72.3 14.4 3.4 9.9 354 Maine 78.7 12.6 3.1 5.5 127 Maryland 62.6 16.4 6.4 14.6 513 Massachusetts 71.8 16.1 3.7 8.4 490 Michigan 65.4 14.7 5.6 14.4 878 Minnesota 57.9 19.8 5.7
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ldrpt103.pdf
  • Northeast 29.7 16.9 0.8 0.0 0.7 7.8 13.0 30.9 76,202 14,942 Southwest 11.7 5.7 4.7 0.0 0.3 40.3 3.2 34.1 111,422 20,047 Total 14.0% 11.8% 4.8% 1.1% 2.9% 18.5% 16.3% 30.7% 900,484 176,750 Region 1 AT&T 2 MCI 3 Sprint Minutes Calls Southeast 18.9% 11.0% 15.4% 15.8% 0.8% 0.0% 4.6% 33.4% 84,900 15,562 West 18.3 13.1 3.3 0.0 22.3 0.0 4.2 38.9 134,230 24,046 West Coast 10.8 16.3 2.7 0.0 2.2 42.9 14.2 10.9 165,300 35,837 Mid-Atlantic 10.7 15.0 4.3 0.0 1.0 0.0 52.9 16.2 192,151 35,662 Mid-West 15.9 10.4 3.8 0.0 1.4 31.0 8.1 29.4 207,733 38,367 Northeast 27.4 18.4 0.7 0.0 1.4 9.8 16.0 26.2 73,682 13,990 Southwest 15.5 7.9 8.0 0.0 0.7 30.5 4.1 33.4 87,031 16,630 Total
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/mksh3q98.pdf
  • Share Based on Operating Revenues of Long Distance Carriers and Total Toll Revenues for Local Exchange Carriers.............................................17 TABLE 3.4 The Toll Market...................................... 18 TABLE 3.5 Quarterly Toll Revenues Reported to Shareholders.............. 19 TABLE 3.6 Toll Revenues by Type of Provider......................... 21 4. RESIDENTIAL LONG DISTANCE MARKET SHARES....................... 22 TABLE 4.1 Market Share of Residential Access Lines by State.............. 23 TABLE 4.2 Market Share of Residential Toll Revenue by State.............. 24 TABLE 4.3 Market Share of Residential Direct Dial Toll Minutes by State...... 25 5. THE INTERNATIONAL LONG DISTANCE TELEPHONE MARKET............. 26 TABLE 5.1 International Telephone Service........................... 27 APPENDIX 1: AT&T'S MARKET SHARE................................. 28 CHART A1.1 AT&T Share of Interstate Minutes........................ 29 CHART A1.2 Indicators of AT&T Market Share........................ 30 APPENDIX 2:
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/mksh4q98.pdf
  • Share Based on Operating Revenues of Long Distance Carriers and Total Toll Revenues for Local Exchange Carriers.............................................17 TABLE 3.4 The Toll Market...................................... 18 TABLE 3.5 Quarterly Toll Revenues Reported to Shareholders.............. 19 TABLE 3.6 Toll Revenues by Type of Provider......................... 21 4. RESIDENTIAL LONG DISTANCE MARKET SHARES....................... 22 TABLE 4.1 Market Share of Residential Access Lines by State.............. 23 TABLE 4.2 Market Share of Residential Toll Revenue by State.............. 24 TABLE 4.3 Market Share of Residential Direct Dial Toll Minutes by State...... 25 5. THE INTERNATIONAL LONG DISTANCE TELEPHONE MARKET............. 26 TABLE 5.1 International Telephone Service........................... 27 APPENDIX 1: AT&T'S MARKET SHARE................................. 28 CHART A1.1 AT&T Share of Interstate Minutes........................ 29 CHART A1.2 Indicators of AT&T Market Share........................ 30 APPENDIX 2:
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/pntris02.pdf
  • 14,039 14,322 13,768 13,540 11,833 11,998 11,625 11,542 11,739 16,674 16,777 10,631 10,513 9,271 9,061 9,176 9,016 9,234 14,299 14,123 7,342 7,275 6,482 6,714 6,607 6,714 6,643 10,746 10,395 12,323 12,746 10,966 11,435 12,337 13,209 13,459 22,296 22,648 57,079 56,941 49,682 50,311 50,353 50,785 51,016 78,054 78,265 * Current dollar equivalents are at the end of Table 4 58 Alabama 4.2 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.7 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.6 Hawaii 3.1 Oregon 3.1 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/pntris03.pdf
  • 11,998 11,625 11,542 11,739 16,674 16,777 17,472 10,631 10,513 9,271 9,061 9,176 9,016 9,234 14,299 14,123 13,919 7,342 7,275 6,482 6,714 6,607 6,714 6,643 10,746 10,395 10,426 12,323 12,746 10,966 11,435 12,337 13,209 13,459 22,296 22,648 21,654 57,079 56,941 49,682 50,311 50,353 50,785 51,016 78,054 78,265 78,310 * Current dollar equivalents are at the end of Table 4 58 Alabama 4.2 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.7 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.6 Hawaii 3.1 Oregon 3.1 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/pntris04.pdf
  • 11,625 11,542 11,739 16,674 16,777 17,472 16,791 10,513 9,271 9,061 9,176 9,016 9,234 14,299 14,123 13,919 13,409 7,275 6,482 6,714 6,607 6,714 6,643 10,746 10,395 10,426 10,298 12,746 10,966 11,435 12,337 13,209 13,459 22,296 22,648 21,654 21,750 56,941 49,682 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 * Current dollar equivalents are at the end of Table 4 58 Alabama 4.2 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.7 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.5 Hawaii 3.1 Oregon 3.1 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/quarterly_roll-upsasof110110.pdf
  • SMR Telephony Carriers Paging & Messaging Service Providers 60.6 255.2 34.8 33.6 -3.3 33.1 1.5 Specialized Mobile Radio (SMR) Dispatch * 52.6 4.4 13.2 201.1 12.9 3.0 Wireless Data and Other Mobile Service 1.0 52.8 16.7 16.2 -2.9 15.8 2.7 Providers Wireless Service Providers 1,127.8 19,684.2 4,435.7 4,834.8 9.0 4,702.9 2.7 Interexchange Carriers (IXCs) 3,235.7 12,443.1 8,954.7 8,078.5 -9.8 7,736.2 4.2 Operator Service Providers (OSPs) 7.6 118.7 47.4 48.1 1.4 42.0 12.6 Prepaid Calling Card Providers 3.7 123.6 121.5 121.0 -0.4 120.6 0.3 Satellite Service Providers 35.3 64.1 52.2 53.0 1.5 52.4 1.1 Toll Resellers 1,106.2 2,111.3 1,269.0 1,396.0 10.0 1,315.8 5.7 Other Toll Carriers 8/ 512.0 93.6 63.8 66.8 4.7 63.0 5.7 Toll Service Providers 4,900.4 14,954.4 10,508.6 9,763.4 -7.1
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ref02.pdf
  • 1.7 0.95% 24.1 49.7 42.3 192.1 1.9 0.99% 26.0 50.6 43.1 208.1 2.2 1.06% 26.5 52.5 44.7 219.1 2.4 1.10% 26.7 54.3 46.2 232.6 2.7 1.16% 26.9 53.4 47.2 239.8 2.8 1.17% 26.8 52.9 48.4 257.9 3.1 1.20% 27.2 53.5 48.9 270.6 3.3 1.22% 28.1 54.5 49.8 285.3 3.6 1.26% 28.9 56.1 51.3 294.6 3.9 1.32% 29.1 57.4 52.5 318.1 4.2 1.32% 29.6 58.3 53.3 332.4 4.5 1.36% 29.9 58.5 53.5 342.6 4.8 1.41% 30.2 58.5 53.5 363.4 5.1 1.41% 30.6 58.6 53.6 383.0 5.5 1.44% 31.0 58.6 53.6 411.4 5.9 1.45% 31.5 57.7 52.7 444.3 6.5 1.46% 81 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ref98.pdf
  • 3.8 Use of Commodities by the U.S. Communications Industry......................................63 C. Additional Sources of Information on Expenditures for Telephone Service...........................................65 IV. Price Indices..................................................66 A. Consumer Price Indices.......................................66 Table 4.1 Changes in the Consumer Price Indices Since 1980...67 Chart 1 Consumer Price Indices for Toll Service since 1984....68 Chart 2 Consumer Price Indices for Toll Service since 1984, Adjusted for Inflation............................69 Table 4.2 Monthly Consumer Price Indices...................70 Table 4.3 New Consumer Price Indices......................78 B. Producer Price Indices........................................79 Table 4.4 Monthly Producer Price Indices....................80 Table 4.5 Discontinued Monthly Producer Price Indices.........85 C. Sources of Additional Information on Price Indices.................101 Appendix A - Long-term Trends.......................................102 Customer Response Survey.........................................110 1 I. Rates for Local Service The billing structure for local telephone service can be broadly classified
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ref99.pdf
  • of Commodities by the U.S. Communications Industry...................................65 C. Additional Sources of Information on Expenditures for Telephone Service.......................................67 IV. Price Indices..............................................68 A. Consumer Price Indices...................................68 Table 4.1 Changes in the Consumer Price Indices Since 1980...69 Chart 1 Consumer Price Indices for Toll Service since 1984...70 (Adjusted for inflation) Chart 2 Consumer Price Indices for Toll Service since 1984. . .71 Table 4.2 Monthly Consumer Price Indices..............72 Table 4.3 New Consumer Price Indices...................79 B. Producer Price Indices....................................80 Table 4.4 Monthly Producer Price Indices..................81 Table 4.5 Discontinued Monthly Producer Price Indices........86 C. Sources of Additional Information on Price Indices................94 Appendix A - Long-term Trends.....................................95 Customer Response Survey .......................................103 iv I. Rates for Local Service The billing structure for local telephone service can be broadly
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/strev-97.pdf
  • PENNSYLVANIA 5,159,358 249,795 2,117,077 5,395,450 261,2262,213,954 77.4 13.2 9.4 RHODE ISLAND 416,851 25,943 168,853 416,851 25,943 168,853 100.0 0.0 0.0 SOUTH CAROLINA 1,097,916 44,379 402,104 1,488,292 60,158 545,077 65.5 13.9 20.6 SOUTH DAKOTA 179,261 10,728 76,010 273,637 16,376 116,027 65.5 0.0 34.5 TENNESSEE 2,019,136 63,121 693,353 2,306,582 72,107 792,059 80.0 10.4 9.6 TEXAS 7,272,799 797,649 2,674,565 7,722,253 846,9432,839,851 77.7 18.1 4.2 UTAH 699,841 22,500 318,187 733,651 23,587 333,559 95.4 1.9 2.7 VERMONT 202,454 20,674 83,776 239,022 24,408 98,908 84.7 0.0 15.3 VIRGINIA 2,754,677 83,064 1,356,873 2,824,184 85,1601,391,110 76.0 21.5 2.5 WASHINGTON 2,261,726 77,928 837,470 2,431,270 83,770 900,249 68.0 25.0 7.0 WEST VIRGINIA 583,556 19,064 179,118 699,049 22,837 214,568 83.5 14.9 1.6 WISCONSIN 1,778,673 66,491 778,513 2,178,580 81,440 953,550 67.0 15.8 17.1
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0301.pdf
  • Mexico 85.3 91.3 6.0 * New York 90.8 95.1 4.3 * North Carolina 89.3 93.3 4.0 * North Dakota 95.1 95.0 -0.1 Ohio 92.2 95.4 3.2 * Oklahoma 91.5 92.9 1.4 Oregon 91.2 94.6 3.4 * Pennsylvania 95.1 97.1 2.0 * Rhode Island 93.3 95.8 2.5 South Carolina 81.8 93.1 11.3 * South Dakota 92.7 95.7 3.0 Tennessee 87.6 91.8 4.2 * Texas 89.0 93.6 4.6 * Utah 90.3 96.2 5.9 * Vermont 92.7 97.1 4.4 * Virginia 93.1 94.3 1.2 Washington 92.5 95.9 3.5 * West Virginia 88.1 92.8 4.7 * Wisconsin 94.8 96.2 1.4 Wyoming 89.7 94.2 4.5 * Total United States 91.4 94.6 3.2 * * Increase is statistically significant at the 95% confidence level. # Decrease is
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0304.pdf
  • United States 6 Chart 1 90 92 94 96 98 Month (March, July, November) Percent with Telephone N83M84J84N84M85J85N85M86J86N86M87J87N87M88J88N88M89J89N89M90J90N90M91J91N91M92J92N92M93J93N93M94J94N94M95J95N95M96J96N96M97J97N97M98J98N98M99J99N99M00J00N00M01J01N01M02J02N02M03J03N03M04 In Housing Unit Available Telephone Penetration Households 7 Table 2 Telephone Penetration by State (Percentage of Households with Telephone Service) State Alabama 87.9% 91.7% 3.8% Alaska 83.8 96.2 12.4 * Arizona 88.8 93.4 4.7 * Arkansas 88.2 88.8 0.6 California 91.7 95.9 4.2 * Colorado 94.4 97.0 2.6 * Connecticut 95.5 98.1 2.6 * Delaware 95.0 96.1 1.1 District of Columbia 94.7 93.2 -1.5 Florida 85.5 93.7 8.2 * Georgia 88.9 92.1 3.2 Hawaii 94.6 95.3 0.7 Idaho 89.5 96.8 7.3 * Illinois 95.0 90.4 -4.6 Indiana 90.3 91.3 1.0 Iowa 95.4 95.2 -0.2 Kansas 94.9 94.0 -0.9 Kentucky 86.9 90.8 3.9 *
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0703.pdf
  • Mississippi 82.4 92.5 10.2 * Missouri 92.1 95.2 3.1 Montana 92.8 92.7 -0.1 Nebraska 94.0 95.9 1.9 Nevada 89.4 94.3 4.9 * New Hampshire 95.0 98.0 3.1 * New Jersey 94.1 96.6 2.5 * New Mexico 85.3 90.4 5.0 * New York 90.8 95.4 4.5 * North Carolina 89.3 92.9 3.6 * North Dakota 95.1 93.7 -1.4 Ohio 92.2 96.4 4.2 * Oklahoma 91.5 90.8 -0.7 Oregon 91.2 96.9 5.7 * Pennsylvania 95.1 97.2 2.1 * Rhode Island 93.3 96.3 3.0 South Carolina 81.8 94.4 12.6 * South Dakota 92.7 92.9 0.2 Tennessee 87.6 94.2 6.6 * Texas 89.0 93.1 4.2 * Utah 90.3 96.9 6.6 * Vermont 92.7 97.7 5.0 * Virginia 93.1 96.0 2.9 Washington 92.5 96.8 4.4 *
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0704.pdf
  • Massachusetts 94.3 96.3 1.9 Michigan 93.8 93.8 0.1 Minnesota 96.4 96.6 0.3 Mississippi 82.4 89.2 6.9 * Missouri 92.1 92.0 0.0 Montana 92.8 92.8 0.0 Nebraska 94.0 96.5 2.5 * Nevada 89.4 90.9 1.5 New Hampshire 95.0 97.5 2.5 New Jersey 94.1 94.3 0.2 New Mexico 85.3 91.5 6.2 * New York 90.8 94.3 3.5 * North Carolina 89.3 93.5 4.2 * North Dakota 95.1 94.4 -0.7 Ohio 92.2 96.1 3.9 * Oklahoma 91.5 88.7 -2.8 Oregon 91.2 96.1 4.9 * Pennsylvania 95.1 95.6 0.5 Rhode Island 93.3 96.0 2.7 South Carolina 81.8 93.3 11.5 * South Dakota 92.7 92.1 -0.6 Tennessee 87.6 94.0 6.4 * Texas 89.0 92.8 3.8 * Utah 90.3 95.7 5.4 * Vermont 92.7 96.0 3.3 Virginia
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0798.pdf
  • 83.8 94.4 10.7 * Arizona 88.8 91.0 2.2 Arkansas 88.2 88.2 0.1 California 91.7 95.3 3.6 * Colorado 94.4 95.8 1.4 Connecticut 95.5 96.2 0.7 Delaware 95.0 96.8 1.8 District of Columbia 94.7 90.6 -4.1 ** Florida 85.5 92.2 6.7 * Georgia 88.9 92.2 3.3 Hawaii 94.6 96.1 1.5 Idaho 89.5 93.4 3.9 Illinois 95.0 93.3 -1.7 Indiana 90.3 94.5 4.2 * Iowa 95.4 97.3 1.9 Kansas 94.9 93.2 -1.7 Kentucky 86.9 93.6 6.7 * Louisiana 88.9 91.7 2.7 Maine 90.7 97.7 7.0 * Maryland 96.3 96.9 0.6 Massachusetts 94.3 94.0 -0.3 Michigan 93.8 95.3 1.5 Minnesota 96.4 97.7 1.3 Mississippi 82.4 89.3 6.9 * Missouri 92.1 93.6 1.5 Montana 92.8 93.9 1.1 Nebraska 94.0 96.7 2.7 Nevada 89.4 90.7 1.3
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1100.pdf
  • 94.6 3.6 * Nebraska 95.7 97.3 1.7 * Nevada 90.4 94.0 3.6 * New Hampshire 94.3 97.7 3.3 * New Jersey 94.8 94.6 -0.2 New Mexico 82.0 91.2 9.2 * New York 91.8 95.1 3.3 * North Carolina 88.3 93.9 5.6 * North Dakota 94.6 95.8 1.2 * Ohio 92.4 94.8 2.4 * Oklahoma 90.3 91.2 0.9 Oregon 90.6 94.8 4.2 * Pennsylvania 94.9 96.6 1.8 * Rhode Island 93.6 94.9 1.3 South Carolina 83.7 93.2 9.5 * South Dakota 93.2 94.3 1.1 Tennessee 88.5 95.5 7.0 * Texas 88.4 93.5 5.1 * Utah 92.5 95.9 3.4 * Vermont 92.3 95.6 3.3 * Virginia 93.1 95.4 2.3 * Washington 93.0 94.9 1.9 * West Virginia 87.7 94.0 6.3 * Wisconsin 95.2
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1196.pdf
  • 2.6 * Colorado 93.2 95.5 2.2 * Connecticut 95.5 97.5 2.0 * Delaware 94.3 96.1 1.8 District of Columbia 94.9 93.0 -1.9 Florida 88.7 93.1 4.4 * Georgia 86.2 89.7 3.5 * Hawaii 93.5 94.8 1.3 Idaho 90.7 92.9 2.2 Illinois 94.2 93.0 -1.2 Indiana 91.6 93.7 2.2 * Iowa 96.2 96.6 0.4 Kansas 94.3 93.9 -0.4 Kentucky 88.1 92.3 4.2 * Louisiana 89.7 91.1 1.4 Maine 93.4 96.5 3.1 * Maryland 95.7 96.7 1.0 Massachusetts 95.9 95.7 -0.2 Michigan 92.8 95.0 2.1 * Minnesota 95.8 97.1 1.3 Mississippi 82.4 87.5 5.2 * Missouri 91.5 95.3 3.9 * Montana 91.0 94.3 3.3 * Nebraska 95.7 96.0 0.3 Nevada 90.4 93.5 3.1 * New Hampshire 94.3 96.1 1.8 New Jersey 94.8 93.6
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev-98.pdf
  • 0.1 0.1 0.2 58.0 49.2 107.2 8,495.1 9,441.117,936.2 Total per-minute access charges 25.9 0.1 26.0 0.1 0.1 0.2 128.1 49.2 177.3 9,007.9 9,441.118,449.0 24Local private line & special access 2.1 * 2.1 10.9 38.4 49.3 1,157.7 4,697.0 5,854.8 25Pay telephone compensation from toll carriers 0.6 0.6 1.2 1.7 1.3 3.0 204.2 221.7 425.9 26Other local telecommunications service revenues 3.9 3.9 4.2 10.9 15.2 351.6 81.2 432.8 27Universal service support receipts 5.9 1.2 7.1 385.1 1,020.9 1,406.1 Total fixed local service provided for resale 33.9 1.2 35.1 0.1 0.1 0.2 167.5 101.2 268.7 12,404.216,802.229,206.5 Mobile service: 28Wireless telephony, paging & messaging, and other mobile 2,177.7 85.8 2,263.5 482.7 81.7 564.4 29.4 * 29.4 2,876.8 167.8 3,044.6 service monthly, activation, and message charges
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev02.pdf
  • revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For the years 1992 - 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing and
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev03.pdf
  • revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For the years 1992 - 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriers represents 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing and
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend100.pdf
  • 20 OR MORE COMPLAINTS......................3-4 TABLE 3.3 COMPLAINT INDICES FOR LECS SERVED 20 OR MORE COMPLAINTS.....................3-6 TABLE 3.4 BILLING AGENTS SERVED MORE THAN 20 COMPLAINTS.......................................3-6 TABLE 3.5 SLAMMING COMPLAINTS: INDICES FOR IXCS SERVED 40 OR MORE.....................3-7 TABLE 3.6 COMPANIES SERVED 20 OR MORE CRAMMING COMPLAINTS.................................3-9 CONSUMER EXPENDITURES..............................................................................................4-1 TABLE 4.1 HOUSEHOLD EXPENDITURES FOR TELEPHONE SERVICE.........................................4-3 CHART 4.1 MONTHLY TELEPHONE SERVICE EXPENDITURES...................................................4-3 TABLE 4.2 HOUSEHOLD TELECOMMUNICATIONS EXPENDITURES BY TYPE OF PROVIDER........4-4 EMPLOYMENT AND LABOR PRODUCTIVITY...............................................................5-1 TABLE 5.1 ANNUAL AVERAGE NUMBER OF EMPLOYEES IN THE TELEPHONE COMMUNICATIONS INDUSTRY.................................................................................5-3 CHART 5.1 ANNUAL AVERAGE NUMBER OF EMPLOYEES IN THE TELEPHONE COMMUNICATIONS INDUSTRY................................................................................5-3 TABLE 5.2 LABOR PRODUCTIVITY INDEX FOR THE TELEPHONE COMMUNICATIONS MEASURED IN OUTPUT PER HOUR...........................................................................5-4 CHART 5.2 TELEPHONE COMMUNICATIONS INDUSTRY (SIC 481) LABOR PRODUCTIVITY INDEX.....................................................................................................................5-4 EQUAL
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend199.pdf
  • 6 - 3 INTERNATIONAL TELEPHONE SERVICE: International telecommunications has become an increasingly important segment of the telecommunications market. International telephone calling -- propelled by technological innovation, increased international trade and travel, and stable or declining international telephone rates -- has skyrocketed. The number of calls made from the United States to other countries increased from 200 million in 1980 to 4.2 billion in 1997. (The initial filings for 1998 are due from the carriers by July 31, 1999. In 1997, Americans spent about $15 billion on international calls.) On average, carriers billed $0.67 per minute for international calls in 1997, a decline of 50% since 1980. International private line revenues have also increased since 1980, but telex and telegraph services declined
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend200.pdf
  • for Other Reasons1 Numbers Still Numbers Still Ported on Ported on 7 Month Annualized YearMonth January 1, 2000August 1, 2000DifferenceChurn Rate (%) Churn Rate2 (%) 1997December 80 80 0 0.0% 0.0% 1998January 202 202 0 0.0 0.0 February 11 9 2 18.2 31.2 March 231 229 2 0.9 1.5 April 547 503 44 8.0 13.8 May 1,975 1,927 48 2.4 4.2 June 5,257 4,872 385 7.3 12.6 July 14,494 13,830 664 4.6 7.9 August 29,918 27,446 2,472 8.3 14.2 September 36,011 33,825 2,186 6.1 10.4 October 100,992 92,340 8,652 8.6 14.7 November 108,952 105,541 3,411 3.1 5.4 December 147,071 140,693 6,378 4.3 7.4 1999January 158,256 146,107 12,149 7.7 13.2 February 180,952 172,942 8,010 4.4 7.6 March 214,692 203,392 11,300 5.3 9.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend298.pdf
  • 282 1,480 0.19 Citizens Utilities Company 136 860 0.16 Frontier Communications 64 667 0.10 ALLTEL 112 1,269 0.09 Cincinnati Bell 55 670 0.08 Sprint Corporation (United) 424 5,290 0.08 TABLE 3.3 BILLING AGENTS SERVED WITH MORE THAN 50 COMPLAINTS IN 1997 Complaints Revenue Complaint Billing Agents Served (Millions) Index Billing Concepts Corp. 6,059 $2,011 3.0 OAN Services, Inc. 3,477 827 4.2 Integretel 1,522 390 3.9 International Telemedia Associates, Inc. 953 124 7.7 HOLD Billing Services 553 127 4.4 Telephone Billing Service 338 Long Distance Billing Company, Inc. 237 Crown Communications 121 13 TABLE 3.4 OTHER COMPANIES SERVED WITH MORE THAN 50 COMPLAINTS IN 1997 Complaints Company Served Long Distance Services, Inc. (MI) 1,688 Trans National Telephone 1,182 American Business Alliance 1,119
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend299.pdf
  • line, the representative charge for service was $41.28 in October 1998 as compared to $41.21 in 1990. Twenty million households have been added to the nation's telephone system since November 1983. As of March 1999, 98.5 million households had telephone service. The number of calls made from the United States to other countries increased from 200 million in 1980 to 4.2 billion in 1997. In 1997, Americans spent about $15 billion on international calls. On average, carriers billed $0.67 per minute for international calls in 1997, a decline of 50% since 1980. There are currently three toll free prefixes in use - 800, 888, 877 - with almost 20 million toll free numbers assigned as of the end of August 1999.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend502.pdf
  • 13.2 10.6 5,488 Florida 49.4 21.5 9.1 20.0 223,503 Georgia 48.7 29.3 3.3 18.8 62,360 Idaho 35.1 19.9 6.7 38.3 17,348 Illinois 46.3 22.0 6.4 25.3 102,295 Indiana 51.9 17.6 7.2 23.3 54,944 Iowa 40.7 25.0 4.5 29.8 34,979 Kansas 34.1 12.5 19.2 34.1 19,707 Kentucky 49.5 15.5 7.9 27.1 35,217 Louisiana 49.2 16.4 5.1 29.4 34,739 Maine 43.5 22.0 4.2 30.3 5,812 Maryland 39.6 32.3 5.8 22.3 62,912 Massachusetts 57.4 20.3 10.1 12.1 25,218 Michigan 51.8 15.4 9.3 23.6 89,987 Minnesota 46.1 23.7 7.8 22.4 56,207 Mississippi 59.0 25.3 2.7 13.0 22,046 Missouri 46.5 11.2 12.4 29.9 26,396 Montana 44.0 11.3 5.0 39.7 13,359 Nebraska 41.7 24.8 8.9 24.6 18,079 Nevada 37.2 20.4 11.9 30.4 25,971 New Hampshire 47.1 21.1
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend504.pdf
  • 143,341,581 2.8 142,367,463 2.0 1993 148,106,159 3.3 147,033,132 3.3 1994 153,447,946 3.6 151,543,061 3.1 1995 159,658,662 4.0 158,152,644 4.4 1996 166,445,580 4.3 165,350,308 4.6 1997 173,866,799 4.5 173,857,193 5.1 1998 179,849,045 3.4 180,516,161 3.8 1999 189,501,938 185,002,911 2.9 186,594,497 3.4 2000 192,555,081 1.6% 188,499,346 1.9 187,581,092 0.5 2001 191,697,023 -0.4 185,588,179 -1.5 179,811,283 -4.1 2002 187,523,916 -2.2 180,110,858 -3.0 172,265,210 -4.2 NA - Not Available. 1 Include end-user switched access lines for competitive local exchange carriers (CLECs) and incumbent local exchange carriers (ILECs) as reported in FCC Form 477. Carriers with greater than 10,000 lines in a state are required to report. 2 Include end-user switched access lines, resold lines, and unbundled network elements (UNEs). 3 Beginning in 2001, a substantial
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend605.pdf
  • 143,341,581 2.8 142,367,463 2.0 1993 148,106,159 3.3 147,033,132 3.3 1994 153,447,946 3.6 151,543,061 3.1 1995 159,658,662 4.0 158,152,644 4.4 1996 166,445,580 4.3 165,350,308 4.6 1997 173,866,799 4.5 173,857,193 5.1 1998 179,849,045 3.4 180,516,161 3.8 1999 189,501,938 185,002,911 2.9 186,594,497 3.4 2000 192,512,938 1.6% 188,499,632 1.9 187,581,092 0.5 2001 191,697,023 -0.4 185,587,229 -1.5 179,811,283 -4.1 2002 189,389,840 -1.2 180,098,691 -3.0 172,265,210 -4.2 2003 183,042,370 -3.4 173,136,837 -3.9 162,497,356 -5.7 NA - Not Available. 1 Include end-user switched access lines for competitive local exchange carriers (CLECs) and incumbent local exchange carriers (ILECs) as reported in the FCC Form 477. Carriers with greater than 10,000 lines in a state are required to report. 2 Include end-user switched access lines, resold lines, and UNE-P lines.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend801.pdf
  • 13.2 10.6 5,488 Florida 49.4 21.5 9.1 20.0 223,503 Georgia 48.7 29.3 3.3 18.8 62,360 Idaho 35.1 19.9 6.7 38.3 17,348 Illinois 46.3 22.0 6.4 25.3 102,295 Indiana 51.9 17.6 7.2 23.3 54,944 Iowa 40.7 25.0 4.5 29.8 34,979 Kansas 34.1 12.5 19.2 34.1 19,707 Kentucky 49.5 15.5 7.9 27.1 35,217 Louisiana 49.2 16.4 5.1 29.4 34,739 Maine 43.5 22.0 4.2 30.3 5,812 Maryland 39.6 32.3 5.8 22.3 62,912 Massachusetts 57.4 20.3 10.1 12.1 25,218 Michigan 51.8 15.4 9.3 23.6 89,987 Minnesota 46.1 23.7 7.8 22.4 56,207 Mississippi 59.0 25.3 2.7 13.0 22,046 Missouri 46.5 11.2 12.4 29.9 26,396 Montana 44.0 11.3 5.0 39.7 13,359 Nebraska 41.7 24.8 8.9 24.6 18,079 Nevada 37.2 20.4 11.9 30.4 25,971 New Hampshire 47.1 21.1
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend803.pdf
  • 30.7% 900,484 Direct Dial InterLATA Minutes Southeast 33.6% 17.5% 14.2% 1.4% 1.9% 0.0% 3.6% 27.8% 398,307 West 29.0 22.8 8.2 0.0 0.0 0.0 1.7 38.2 258,900 West Coast 31.6 19.0 9.1 0.0 2.6 0.3 6.8 30.6 231,347 Mid-Atlantic 34.7 20.5 8.7 0.0 2.6 0.0 3.9 29.5 282,984 Mid-West 31.0 18.7 6.7 0.0 1.7 0.0 6.0 35.9 296,070 Northeast 32.8 12.8 4.2 0.0 0.9 6.2 19.2 23.9 187,217 Southwest 24.0 13.3 8.1 0.0 1.5 19.9 2.7 30.4 226,761 Total 31.2% 18.1% 9.0% 0.3% 1.6% 3.1% 5.6% 31.0%1,881,586 Table 9.10 Residential Market Share By Region: 2002 BellSouth 4Qwest 5 SBC 6 Verizon 7 Other 8 9 - 15 Source: Calculated by Industry Analysis and Technology Division staff using survey data from TNS Telecoms
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trsrv-95.pdf
  • Total Intrastate Total Interstate Total Carrier in Revenue Revenue Revenue Category Local Exchange Service ** 0.0% ** 0.0% ** 0.0% 0.0% Local Private Line Service $0.0 0.0 $0.0 0.0 $0.0 0.0 n.a. Cellular, PCS, Paging & Other Mobile ** 0.0 ** 0.0 ** 0.0 30.0 Alternative Access and Other $0.0 0.0 $0.0 0.0 $0.0 0.0 n.a. Total Local Revenues $7.7 4.2 $3.3 1.0 $10.9 2.1 30.0 Interstate Access $0.0 0.0 $10.2 3.1 $10.2 2.0 100.0 Intrastate Access $5.9 3.2 $0.0 0.0 $5.9 1.2 0.0 Total Access Revenues $5.9 3.2 $10.2 3.1 $16.1 3.2 63.4 Operator Service, Pay Telephone & Card $157.8 86.1 $289.0 88.3 $446.8 87.5 64.7 Non-Operator Switched Toll Service $7.5 4.1 $12.9 3.9 $20.3 4.0 63.3 Long Distance Private
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trsrv-96.pdf
  • 4 Revenue: Percentage Change in Revenue From 1995 to 1996 (All Carriers Reporting Interstate Revenues) Intrastate Interstate Intrastate + Interstate Local Exchange Service 7.7% 84.2% 7.8% Local Private Line Service 23.1 2391.7 31.8 Cellular, PCS, Paging & Other Mobile 39.6 27.0 38.9 Other Local 0.3 7.2 1.1 Total Local Revenues 14.7 22.2 15.0 Interstate Access n.a. 5.2 5.4 Intrastate Access 4.2 n.a. 4.1 Total Access Revenues 5.0 5.1 5.1 Operator Service, Pay Telephone & Card 5.4 -6.2 -1.7 Non-operator Switched Toll Service 11.0 10.9 10.9 Long Distance Private Line Service 13.5 8.4 9.7 All Other Long Distance 57.1 51.4 52.8 Total Toll Revenues 12.0 10.8 11.2 Total Carrier Revenue 13.1 9.4 11.5 Telecommunications Industry Table 5 Revenue: Toll Carriers: IXCs, OSPs,
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2000.pdf
  • Alabama 5,363 35.2 299 2.0 940 6.2 489 3.2 297 1.9 7,869 51.6 15,257 Alaska 819 18.8 19 0.4 84 1.9 42 1.0 19 0.4 3,382 77.5 4,365 Arizona 8,715 53.1 194 1.2 566 3.4 481 2.9 325 2.0 6,139 37.4 16,420 Arkansas 2,374 27.4 601 6.9 260 3.0 181 2.1 83 1.0 5,161 59.6 8,660 California 56,588 41.7 5,678 4.2 3,153 2.3 3,768 2.8 1,845 1.4 64,570 47.6 135,602 Colorado 8,865 50.2 174 1.0 349 2.0 598 3.4 308 1.7 7,353 41.7 17,647 Connecticut 5,275 43.5 898 7.4 330 2.7 233 1.9 251 2.1 5,150 42.4 12,139 Delaware 1,418 36.4 91 2.3 69 1.8 53 1.4 38 1.0 2,224 57.1 3,893 District of Columbia 2,693 54.6 57 1.2 594 12.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2001.pdf
  • 1.5 404 1.6 612 2.5 363 1.5 14,489 58.9 24,591 Iowa 4,136 30.2 155 1.1 211 1.5 527 3.9 300 2.2 8,351 61.0 13,681 Kansas 3,858 26.8 800 5.6 247 1.7 242 1.7 172 1.2 9,057 63.0 14,376 Kentucky 5,591 33.0 573 3.4 189 1.1 468 2.8 245 1.4 9,880 58.3 16,946 Louisiana 6,658 37.0 1,388 7.7 157 0.9 764 4.2 240 1.3 8,789 48.8 17,996 Maine 1,875 38.3 17 0.3 93 1.9 70 1.4 26 0.5 2,818 57.5 4,900 Maryland 10,880 45.5 282 1.2 407 1.7 679 2.8 294 1.2 11,374 47.6 23,916 Massachusetts 15,401 44.0 275 0.8 589 1.7 720 2.1 250 0.7 17,744 50.7 34,979 Michigan 15,002 31.8 468 1.0 1,001 2.1 1,271 2.7 689 1.5 28,678 60.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationjun2003.pdf
  • 1.0 129 2.2 80 1.4 3,259 56.7 5,752 Illinois 22,264 38.9 1,211 2.1 790 1.4 1,203 2.1 642 1.1 31,088 54.4 57,198 Indiana 9,047 35.3 391 1.5 358 1.4 482 1.9 266 1.0 15,095 58.9 25,639 Iowa 4,490 26.9 129 0.8 219 1.3 250 1.5 135 0.8 11,487 68.7 16,711 Kansas 3,748 23.0 886 5.4 78 0.5 228 1.4 691 4.2 10,640 65.4 16,272 Kentucky 5,686 30.2 814 4.3 115 0.6 360 1.9 212 1.1 11,632 61.8 18,818 Louisiana 6,419 32.3 1,681 8.5 193 1.0 518 2.6 183 0.9 10,853 54.7 19,846 Maine 2,085 38.6 19 0.3 64 1.2 79 1.5 19 0.4 3,142 58.1 5,407 Maryland 10,975 47.6 102 0.4 350 1.5 541 2.3 189 0.8 10,881 47.2 23,037 Massachusetts
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationjun2004.pdf
  • 0.9 248 1.6 222 1.5 7,708 50.5 15,274 Delaware 2,071 50.1 33 0.8 80 1.9 70 1.7 17 0.4 1,865 45.1 4,137 District of Columbia 3,512 66.7 18 0.3 155 2.9 124 2.4 20 0.4 1,435 27.3 5,264 Florida 32,377 48.7 1,545 2.3 390 0.6 2,266 3.4 978 1.5 28,886 43.5 66,443 Georgia 16,408 45.5 1,458 4.0 326 0.9 1,511 4.2 380 1.1 15,945 44.3 36,027 Guam Not shown to protect carrier confidentiality Hawaii 2,560 57.2 7 0.1 12 0.3 113 2.5 71 1.6 1,714 38.3 4,477 Idaho 2,308 39.9 21 0.4 59 1.0 110 1.9 80 1.4 3,199 55.4 5,779 Illinois 23,157 40.3 1,195 2.1 741 1.3 1,069 1.9 588 1.0 30,763 53.5 57,514 Indiana 9,482 37.0 367 1.4 313
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-96.pdf
  • 0.0 0.0 0.0 4,136,54669.623.2 4.7 1.8 0.7 Netherlands $118,315,48862.418.111.9 3.5 4.1 $15,868,26655.723.213.8 6.9 0.4 $11,494,09695.0 3.7 0.7 0.0 0.6 292,669,01545.020.317.9 8.2 8.7 Norway $34,430,58861.922.810.3 2.6 2.3 $6,759,93852.226.314.4 6.9 0.1 $397,50356.139.4 4.6 0.0 0.0 85,116,34749.525.215.9 6.5 3.0 Portugal $41,916,11570.216.7 7.5 2.5 3.1 $6,647,69169.621.5 6.1 2.8 0.0 $3,250,96577.1 5.217.7 0.0 0.0 58,744,35863.018.8 8.4 3.9 5.9 Spain $138,371,40466.915.4 9.8 2.7 5.2 $25,123,43455.125.711.4 3.6 4.2 $1,202,04589.4 7.4 3.2 0.0 0.0 208,790,73753.820.811.4 4.5 9.5 Sweden $66,773,23558.028.3 7.6 4.1 2.1 $8,098,66053.428.410.0 4.4 3.9 $1,589,67156.521.5 6.2 0.015.9 173,651,44147.228.511.4 6.1 6.8 Switzerland $111,891,81161.516.812.5 6.3 2.9 $23,962,08539.626.614.6 6.712.4 $340,89125.254.019.7 0.0 1.0 272,905,32839.520.718.610.211.0 Turkey $61,264,18765.321.110.7 0.4 2.5 $16,835,37356.831.012.2 0.0 0.0 $867,204 0.073.626.4 0.0 0.0 84,287,49057.326.013.4 0.5 2.9 United Kingdom $699,189,46368.215.7 9.9 1.6 4.5 $147,523,97250.223.113.0 5.0 8.8 $11,982,57572.711.514.0 0.0 1.7 1,964,109,20650.923.313.8 4.8
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-97.pdf
  • 8.4 0.4 0.7 $4,708,00643.640.415.8 0.0 0.1 $1,339,632100.0 0.0 0.0 0.0 0.0 83,840,67948.536.613.2 0.6 1.1 Belgium $86,458,00559.622.112.4 3.5 2.5 $10,343,96346.527.312.610.0 3.6 $3,427,230 8.5 7.9 2.3 0.081.3 173,272,93745.123.015.0 9.1 7.9 Cyprus $9,534,85256.225.8 8.1 0.1 9.8 $2,479,90056.420.822.3 0.0 0.5 $339,53843.948.9 7.2 0.0 0.0 13,930,25850.120.715.8 0.113.3 Denmark $45,095,78656.023.510.5 3.8 6.2 $4,188,49144.625.022.7 7.7 0.0 $3,308,60288.4 8.5 3.1 0.0 0.0 104,296,80537.025.718.8 8.110.4 Finland $20,799,22456.427.9 7.9 3.6 4.2 $4,248,12842.719.515.622.3 0.0 $1,016,01792.7 6.7 0.6 0.0 0.0 47,252,20945.822.413.510.1 8.2 France $322,044,82152.535.0 7.8 3.6 1.1 $29,592,33041.027.915.615.2 0.3 $7,141,72866.718.311.0 0.0 4.0 719,308,75541.927.913.913.7 2.5 Germany $503,613,45264.222.2 7.8 3.0 2.8 $34,185,89545.330.9 9.9 9.9 4.0 $8,426,11957.336.5 0.7 0.0 5.5 1,320,125,71643.128.2 9.210.2 9.2 Gibraltar $503,82791.8 0.1 1.9 1.6 4.7 $114,996100.0 0.0 0.0 0.0 0.0 $31,573100.0 0.0 0.0 0.0 0.0 866,25391.0 0.1 1.0 1.3 6.7 Greece $94,234,04061.729.6
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-98.pdf
  • 2.3 4.6 $177,05699.7 0.0 0.1 0.0 0.2 $593,96426.8 0.071.1 0.0 2.1 8,524,85756.7 2.132.7 1.7 6.7 Mauritania $2,688,92189.9 1.6 6.4 1.0 1.1 $161,99699.0 0.0 0.0 0.0 1.0 $315,78099.5 0.0 0.0 0.0 0.5 3,102,27790.1 2.6 4.7 0.8 1.8 Mauritius $16,177,88075.2 2.8 1.014.4 6.6 $448,68884.6 0.0 0.0 0.015.4 $566,42366.9 0.0 0.0 0.033.1 14,617,36462.5 5.1 0.817.813.7 Morocco $55,095,35782.5 0.412.7 2.1 2.3 $2,734,17160.8 0.035.0 0.0 4.2 $1,838,78795.2 0.0 4.5 0.0 0.3 81,291,31182.1 1.110.1 1.5 5.2 Mozambique $3,425,95121.7 0.9 8.5 6.162.8 $185,06194.5 0.0 0.0 0.0 5.5 $421,141100.0 0.0 0.0 0.0 0.0 13,534,190 5.5 0.6 2.3 4.487.2 Namibia $1,371,14061.8 2.011.317.9 6.9 $389,52598.4 0.0 0.0 0.0 1.6 $142,909100.0 0.0 0.0 0.0 0.0 2,296,17857.9 3.2 8.319.910.7 Niger $1,544,37772.8 1.311.610.9 3.3 $191,47199.8 0.0 0.0 0.0 0.2 $235,515100.0 0.0 0.0 0.0 0.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f00.pdf
  • 2.5 8.4 1.9 $574,31628.152.3 0.012.7 6.9 $169,86594.4 2.7 0.0 2.8 0.0 21,005,07734.138.8 1.916.8 8.4 Denmark $31,775,42551.731.9 0.4 7.6 8.4 $2,408,84133.925.3 0.010.030.8 $332,50287.211.0 0.0 1.8 0.0 97,723,96834.131.7 0.410.023.9 Finland $14,471,46643.043.6 0.212.3 0.9 $1,674,26749.433.3 0.012.2 5.0 $248,70166.524.4 0.0 9.1 0.0 40,752,76237.635.8 0.219.4 7.0 France $222,125,50753.227.1 0.511.9 7.3 $13,915,86251.723.5 0.012.412.3 $7,669,11178.016.9 0.0 5.0 0.0 783,604,44936.624.1 0.415.023.9 Germany $410,439,31965.817.9 0.710.3 5.5 $50,303,27076.612.1 0.0 7.1 4.2 $3,225,49563.831.6 0.0 4.2 0.3 1,610,011,23650.519.9 0.611.717.2 Gibraltar $579,83794.0 0.1 0.9 1.6 3.4 $124,18699.7 0.0 0.0 0.0 0.3 $89,729100.0 0.0 0.0 0.0 0.0 1,879,48288.3 0.0 0.5 1.210.0 Greece $132,243,15834.260.9 0.7 3.2 1.0 $5,266,54643.343.1 0.012.9 0.7 $1,562,64139.560.1 0.0 0.4 0.0 252,187,00949.037.1 0.7 8.6 4.6 Greenland $35,85115.044.9 7.931.2 1.0 $838 0.0 0.0 0.0 0.0100.0 $155100.0 0.0 0.0 0.0 0.0 87,186 4.039.5 5.343.7 7.5
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f01.pdf
  • 0.076.310.011.1 2.5 $47,681 0.063.0 0.0 0.037.0 $32,220 0.0100.0 0.0 0.0 0.0 1,394,007 0.042.721.6 5.030.7 Greece $64,683,100 0.061.5 8.326.1 4.1 $3,910,890 0.015.7 6.361.416.6 $275,751 0.044.2 3.950.7 1.2 307,405,103 0.050.2 9.229.211.5 Greenland $51,318 0.0 8.920.354.516.2 $2,110 0.0 0.0 0.0 0.0100.0 $895 0.0 0.6 0.0 0.099.4 170,161 0.0 5.816.945.531.9 Iceland $4,516,315 0.068.114.315.8 1.8 $653,440 0.015.432.847.9 3.9 $121,625 0.089.4 1.8 8.8 0.0 26,398,499 0.039.431.025.3 4.2 Ireland $57,848,166 0.065.012.619.8 2.5 $4,911,711 0.031.8 9.314.244.7 $236,286 0.050.4 4.342.6 2.8 277,384,656 0.032.414.738.114.8 Italy $231,055,002 0.045.115.436.5 3.0 $6,260,094 0.035.717.223.623.6 $280,077 0.093.5 6.5 0.0 0.0 811,380,614 0.023.522.941.911.7 Liechtenstein $34,451 0.0 9.454.2 0.036.4 $3,113 0.0 0.0 0.0 0.0100.0 $0 224,650 0.0 8.932.2 0.059.0 Luxembourg $5,216,531 0.062.415.819.1 2.7 $260,338 0.028.433.823.913.9 $91,353 0.094.9 1.4 3.2 0.5 22,129,190 0.038.826.522.911.8 Malta $3,119,624 0.036.1 4.455.8 3.7 $276,288
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f02.pdf
  • $989,86039.127.2 0.033.5 0.1 $73,60342.3 2.248.4 6.2 0.9 66,543,56730.923.0 2.832.810.5 France $141,490,38152.616.8 0.621.5 8.5 $8,623,29050.2 9.8 0.237.3 2.4 $9,015,36033.9 0.2 1.9 9.155.0 982,168,72435.211.8 2.037.213.8 Germany $301,376,64563.615.6 0.517.7 2.6 $16,772,53346.824.7 0.026.4 2.1 $19,786,899 0.3 0.1 0.7 0.098.9 1,920,484,00638.824.7 1.326.5 8.6 Gibraltar $651,08587.1 6.3 0.3 5.3 1.0 $20,006100.0 0.0 0.0 0.0 0.0 $57625.2 0.074.8 0.0 0.0 1,434,68448.525.6 1.519.4 5.1 Greece $47,357,52462.2 8.5 1.623.5 4.2 $2,289,76746.1 9.0 0.044.9 0.0 $706,66947.2 5.111.726.010.0 220,467,17240.610.2 5.431.012.9 Greenland $91,845 1.2 5.7 1.152.639.5 $0 $213 0.0 0.0100.0 0.0 0.0 421,813 0.5 5.6 0.961.032.0 Iceland $3,155,33559.1 3.3 0.734.4 2.5 $648,89140.725.6 0.033.7 0.0 $84,04954.425.5 6.813.3 0.0 21,357,63248.017.7 1.529.7 3.0 Ireland $55,230,77963.1 9.5 1.121.1 5.1 $2,960,05654.715.8 0.028.7 0.8 $778,760 0.2 0.7 9.2 2.887.1 367,453,20634.3 9.9 5.135.415.3 Italy $183,031,70248.912.5 1.234.0 3.4 $4,992,59751.120.8 0.026.3 1.8
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f99.pdf
  • 0.0 7,378,54825.124.022.4 8.020.5 Israel $171,791,35063.515.212.2 0.4 8.7 $30,336,29557.623.916.3 0.0 2.3 $577,84626.067.8 6.1 0.0 0.0 601,147,76945.914.622.7 1.015.8 Jordan $33,460,99960.614.9 8.3 1.814.5 $4,530,70349.819.924.7 0.0 5.6 $1,113,23374.1 2.923.0 0.0 0.0 54,283,61646.219.611.1 3.119.9 Kuwait $45,273,75641.625.027.5 1.5 4.4 $2,028,53916.873.0 9.7 0.0 0.5 $591,04659.425.814.8 0.0 0.0 58,451,58130.029.930.6 2.2 7.3 Lebanon $56,107,34034.032.8 2.0 3.427.8 $5,922,69132.554.8 0.0 0.012.7 $1,983,62965.134.9 0.0 0.0 0.0 80,948,10219.128.8 2.7 5.344.0 Oman $4,780,01558.721.614.2 1.4 4.2 $1,522,77662.018.020.0 0.0 0.0 $674,67550.132.817.1 0.0 0.0 7,699,23156.619.318.1 1.7 4.4 Qatar $5,774,56557.818.318.9 0.6 4.4 $2,501,88357.222.320.4 0.0 0.1 $1,475,76815.014.770.3 0.0 0.0 8,997,31555.715.323.1 0.9 5.0 Saudi Arabia $97,462,36749.732.911.0 1.5 4.8 $24,601,89229.551.618.4 0.0 0.5 $3,779,78864.332.9 2.8 0.0 0.0 143,166,54033.542.615.7 2.3 5.9 Syria $29,078,76957.422.9 5.1 2.212.4 $1,871,48748.344.0 3.0 0.0 4.7 $789,22730.665.1 4.4 0.0 0.0 27,141,16542.516.810.3 6.124.4 United Arab Emirates $55,866,27058.920.915.8 0.3 4.2 $16,472,671 6.171.022.4 0.0
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/crepor03.pdf
  • 42.8 10.2 8.4 Gabon $3,126,156 19.5 8.9 62.9 4.8 4.0 $44,936 39.6 0.0 57.2 0.0 3.2 $100,393 100.0 0.0 0.0 0.0 0.0 15,014,177 21.9 13.9 53.5 4.3 6.5 Gambia, The $3,702,971 23.8 13.8 24.2 14.2 24.0 $33,897 58.5 0.0 20.4 21.0 0.0 $40 100.0 0.0 0.0 0.0 0.0 22,584,044 33.1 14.3 19.4 8.3 24.9 Ghana $51,434,840 50.3 21.8 13.1 10.6 4.2 $386,431 42.5 0.0 41.0 16.4 0.1 $79,049 0.9 0.0 85.4 13.8 0.0 332,302,083 36.6 25.8 18.9 11.6 7.0 Guinea $7,109,161 36.4 27.2 23.8 5.6 7.0 $87,098 72.3 0.0 27.7 0.0 0.0 $277,243 97.8 0.0 2.2 0.0 0.0 59,796,752 46.2 22.2 17.1 5.0 9.4 Guinea-Bissau $2,975,564 68.0 3.9 9.4 7.9 10.8 $0 $0 4,412,299 55.5 5.3 21.9 9.6 7.6 - Switched
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itltrd98.pdf
  • 584 655 747 907 1,025 1,233 1,485 1,723 2,272 2,710 3,124 3,694 4,338 5,442 18.5% Average Minutes per Message U.S. Calls 7.9 8.0 8.0 8.2 8.3 8.1 8.0 7.7 7.4 7.2 7.3 6.6 6.2 5.9 5.8 5.6 5.5 Calls from the U.S. Foreign Calls 7.0 7.1 7.1 6.9 6.8 6.7 6.3 5.9 5.4 5.3 5.3 5.2 4.9 4.7 4.5 4.6 4.2 Calls to the U.S. All Telephone Calls 7.5 7.6 7.6 7.6 7.6 7.6 7.6 7.5 7.2 7.1 7.2 6.1 5.8 5.6 5.5 5.4 5.1 Billed Revenues $2,097 $2,239 $2,382 $2,876 $3,197 $3,487 $4,004 $4,750 $5,800 $6,901 $8,042 $9,096 $10,179 $11,353 $12,255 $13,990 $14,079 9.6% Settlement Payments $1,063 $1,330 $1,674 $2,036 $2,269 $2,398 $2,865 $3,423 $4,039 $4,735 $5,297 $5,792 $5,945 $6,308
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itltrd99.pdf
  • 747 907 1,025 1,233 1,485 1,723 2,272 2,710 3,124 3,694 4,338 5,442 6,307 18.9% Average Minutes per Message U.S. Calls 7.9 8.0 8.0 8.2 8.3 8.1 8.0 7.7 7.4 7.2 7.3 6.6 6.2 5.9 5.8 5.6 5.5 5.3 Calls from the U.S. Foreign Calls 7.0 7.1 7.1 6.9 6.8 6.7 6.3 5.9 5.4 5.3 5.3 5.2 4.9 4.7 4.5 4.6 4.2 4.4 Calls to the U.S. All Telephone Calls 7.5 7.6 7.6 7.6 7.6 7.6 7.6 7.5 7.2 7.1 7.2 6.1 5.8 5.6 5.5 5.4 5.1 5.1 Billed Revenues $2,097 $2,239 $2,382 $2,876 $3,197 $3,487 $4,004 $4,750 $5,800 $6,901 $8,042 $9,096 $10,179 $11,353 $12,255 $13,990 $14,079 $15,125 8.2% Settlement Payments $1,063 $1,330 $1,674 $2,036 $2,269 $2,398 $2,865 $3,423 $4,039 $4,735 $5,297
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itrnd00.pdf
  • 4.0 1964 62.9 13.6 14.6 17.2 58.0 166.3 4,449 4,615 3.6 1965 78.2 15.9 20.2 21.3 50.6 186.2 4,906 5,092 3.7 1966 100.1 17.6 29.0 27.3 49.7 223.7 5,619 5,843 3.8 1967 114.2 15.1 31.3 33.7 49.8 244.0 6,131 6,375 3.8 1968 126.9 15.4 36.6 44.3 50.5 273.8 6,852 7,126 3.8 1969 172.0 16.8 45.4 56.0 53.8 344.0 7,888 8,232 4.2 1970 196.6 15.5 49.9 63.1 53.1 378.2 8,578 8,956 4.2 1971 237.4 12.7 52.0 72.5 49.2 423.8 9,538 9,962 4.3 1972 291.8 14.2 57.7 88.3 44.8 496.9 10,826 11,323 4.4 1973 364.9 15.1 62.8 115.0 47.7 605.5 12,521 13,126 4.6 1974 428.7 12.9 64.1 142.7 52.3 700.8 13,881 14,582 4.8 1975 490.2 13.2 69.2 163.4 42.5 778.5 15,319 16,098 4.8
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itrnd01.pdf
  • 4.0 1964 62.9 13.6 14.6 17.2 58.0 138.1 166.3 4,615 3.6 1965 78.2 15.9 20.2 21.3 50.6 150.1 186.2 5,092 3.7 1966 100.1 17.6 29.0 27.3 49.7 177.2 223.7 5,843 3.8 1967 114.2 15.1 31.3 33.7 49.8 197.7 244.0 6,375 3.8 1968 126.9 15.4 36.6 44.3 50.5 221.8 273.8 7,126 3.8 1969 172.0 16.8 45.4 56.0 53.8 281.8 344.0 8,232 4.2 1970 196.6 15.5 49.9 63.1 53.1 312.8 378.2 8,956 4.2 1971 237.4 12.7 52.0 72.5 49.2 359.1 423.8 9,962 4.3 1972 291.8 14.2 57.7 88.3 44.8 424.9 496.9 11,323 4.4 1973 364.9 15.1 62.8 115.0 47.7 527.6 605.5 13,126 4.6 1974 428.7 12.9 64.1 142.7 52.3 623.7 700.8 14,582 4.8 1975 490.2 13.2 69.2 163.4 42.5 696.1 778.5 16,098 4.8
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/m96-indx.pdf
  • Interstate Access - Originating Non-Premium......................... Table 4.11 Minutes of Use - Interstate Access - Originating Premium ................................ Table 4.8 Minutes of Use - Interstate Access - Terminating Non-Premium ....................... Table 4.12 3 Index of Tables and Charts Minutes of Use - Interstate Access - Terminating Premium ............................... Table 4.9 Minutes of Use - Interstate Access - Tier 1 ........................................................ Table 4.2 Minutes of Use - Interstate Access - Total - Annual .......................................... Table 4.14 Minutes of Use - Interstate Access - Total - Monthly ........................................ Table 4.1 Minutes of Use - Interstate Access - Total - Quarterly ....................................... Table 4.4 Minutes of Use - Interstate Access - Total Non-Premium .................................. Table 4.13 Minutes of Use - Interstate Access - Total Premium
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-4.pdf
  • remaining 2,666 applications represent potentially fundable applications. USAC also reports that it informed 1,384 that their funding commitment letters would be delayed pending further review and investigation, including site visits in some cases, because of concerns regarding certain aspects of their applications.7 As of May 29, 2003, USAC had committed $2.182 billion, and disbursed over 3 See Tables 4.1 and 4.2 for details. 4 Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2003, at 26. 5 Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2003, at 26. 6 See Tables 4.1 and 4.2 for details. 7 Universal Service Administrative Company, Federal Universal Service Support Mechanisms
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-6.pdf
  • Rhode Island 93.6 96.1 2.4 * South Carolina 83.7 94.3 10.6 * South Dakota 93.2 95.1 1.9 Tennessee 88.5 93.6 5.1 * Texas 88.4 94.2 5.8 * Utah 92.5 96.7 4.1 * Vermont 92.3 97.6 5.4 * Virginia 93.1 96.2 3.1 * Washington 93.0 96.4 3.4 * West Virginia 87.7 94.5 6.8 * Wisconsin 95.2 96.1 0.9 Wyoming 89.9 94.0 4.2 * Total United States 91.6 95.3 3.7 * * Increase is statistically significant at the 95% confidence level. # Decrease is statistically significant at the 95% confidence level. Differences may not appear to equal changes due to rounding. 6 - 12 Chart 6.2 6 - 13 94.2% or less 94.3% - 96.3% 96.4% or more Average 2002 Telephone Penetration Chart
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-7.pdf
  • - Food & Beverages * 2.4 - Housing * 2.8 - Apparel 2.7 -0.3 - Transportation 3.7 1.6 - Medical Care 5.2 4.6 - Recreation *** * 1.7 - Other Goods & Services * 4.1 CPI Public Transportation 4.9 2.3 CPI Utility Natural Gas Service 3.8 3.2 CPI Electricity 2.3 1.2 CPI Sewer & Water Maintenance * 4.0 CPI Postage 4.2 3.6 Note:All figures represent average annual rates of change in the December index values. ****** Source: Bureau of Labor Statistics. Chart 7.1 The CPI telephone service index was revised in December of 1997. Series not established until 1993. Figure reflects annual change between 1993 and 2002. Table 7.1 Long-Term Changes for Various Price Indices (Average Annual Rates of Change) Series
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-9.pdf
  • 1,581 802 826 1,005 1,669 7,436 Total Switches 1,637 1,337 1,455 778 1,652 1,279 1,344 3,130 1,563 Switches with Downtime Number of Switches 68 252 201 32 71 34 28 40 136 As a Percentage of Total Switches 4.2% 18.8% 13.8% 4.1% 4.3% 2.7% 2.1% 1.3% 8.7% Average Switch Downtime in Seconds per Switch For All Events 97.8 95.0 90.5 4.2 49.0 36.3 31.2 117.2 460.8 For Unscheduled Events Over 2 Minutes 88.0 78.0 29.5 3.2 44.7 33.6 30.3 118.9 381.1 For Unscheduled Downtime More Than 2 Minutes Number of Occurrences or Events 33 42 25 8 11 26 13 42 71 Events per Hundred Switches 2.0 3.1 1.7 1.0 0.7 2.0 1.0 1.3 4.5 Events per Million Access Lines 1.44
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-intro.pdf
  • Table 5.1 Rural Health Care - Service Speeds Acquired .............................................. Table 5.2 Safety Net Additive Support Payment Projections by Jurisdiction .................... Table 3.9 Safety Net Additive Support Payment Projections by Study Area ..................... Table 3.24 Schools and Libraries Commitments & Disbursements by State & Applicant Type Table 4.1 Schools and Libraries Commitments & Disbursements by State & Service Type ...Table 4.2 Schools and Libraries Commitments per Student ......................................... Table 4.4 Schools and Libraries Disbursements by Service Provider Type .......................... Table 4.3 Schools and Libraries Disbursements per Student ........................................Table 4.5 5 Index of Tables and Charts State Code Reference ............................................................................................... Table 8.13 Subscribership on American Indian Reservations and Trust Land: Federal ..........Table 2.14 Subscribership - Household - United States ........................................................... Table 6.1
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-1.pdf
  • revenues as access revenues. Reporting changes implemented with the Universal Service Worksheet explain the increase in local private line revenues and the fall in access revenues shown for 1997. TRS Worksheet filers included subscriber line charges with other access charges. For the years 1992 - 1996, these revenues have been disaggregated by assuming that the end-user access revenues in Table 4.2 of Statistics of Communications Common Carriersrepresent 93% of industry total subscriber line charge revenues. Universal Service Worksheet filers report subscriber line charges in a separate category. The increase from 1997 to 1998 represents PICC charges levied by ILECs as well as $1.2 billion of PICC pass-through charges levied by toll carriers. 3/ Significant amounts of enhanced services, billing and collection,
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-4.pdf
  • connections installation. Thus, disbursements for the two most recent funding years will rise substantially. 5 USAC reports that for Funding Year 2001 (July 1, 2001 ­ June 30, 2002), only eight applications remained in the program integrity assurance process. Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2004, at 24. See Tables 4.2 and 4.3 for details. 6 USAC reports that for Funding Year 2002 (July 1, 2002 ­ June 30, 2003), only 194 applications remained in the program integrity assurance process. Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2004, at 25. See Tables 4.2 and 4.3 for details. 7 USAC reports that for
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-7.pdf
  • 4.5 3.8 3.6 1984 7.2 3.9 9.2 1985 4.1 3.8 4.7 1986 3.5 1.1 2.7 1987 3.4 4.4 -1.3 1988 4.1 4.4 1.3 1989 3.5 4.6 -0.3 1990 1.9 6.1 -0.4 1991 -0.2 3.1 3.5 1992 3.3 2.9 -0.3 1993 2.7 2.7 1.8 1994 4.0 2.7 0.7 1995 2.5 2.5 1.2 1996 3.7 3.3 2.1 1997 4.5 1.7 0.2 1998 4.2 1.6 0.3* 1999 4.5 2.7 0.4 2000 3.7 3.4 -2.3 2001 0.5 1.6 1.3 2002 2.2 2.4 0.2 2003 3.1 1.9 -2.7 * The CPI telephone service index was revised in December of 1997. Sources: Bureau of Labor Statistics and Bureau of Economic Analysis. Chart 7.2 Table 7.2 Annual Changes in Major Price Indices GDP Chain-type Price Index CPI -
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-intro.pdf
  • Care Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payment Projections by State or Jurisdiction ........... Table 3.7 Safety Net Additive Support Payment Projections by Study Area ..................... Table 3.23 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & Libraries Disbursements per Student .......................................... Chart 4.1 Schools & Libraries Disbursements per Student ..........................................
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-0.pdf
  • Interstate Access - Originating Non-Premium......................... Table 4.11 Minutes of Use - Interstate Access - Originating Premium ................................ Table 4.8 3 Index of Tables and Charts Minutes of Use - Interstate Access - Terminating Non-Premium ....................... Table 4.12 Minutes of Use - Interstate Access - Terminating Premium ............................... Table 4.9 Minutes of Use - Interstate Access - Tier 1 ........................................................ Table 4.2 Minutes of Use - Interstate Access - Total - Annual .......................................... Table 4.14 Minutes of Use - Interstate Access - Total - Monthly ........................................ Table 4.1 Minutes of Use - Interstate Access - Total - Quarterly ....................................... Table 4.4 Minutes of Use - Interstate Access - Total Non-Premium .................................. Table 4.13 Minutes of Use - Interstate Access - Total Premium
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-1.pdf
  • 2.6 * Colorado 93.2 95.5 2.2 * Connecticut 95.5 97.5 2.0 * Delaware 94.3 96.1 1.8 District of Columbia 94.9 93.0 -1.9 Florida 88.7 93.1 4.4 * Georgia 86.2 89.7 3.5 * Hawaii 93.5 94.8 1.3 Idaho 90.7 92.9 2.2 Illinois 94.2 93.0 -1.2 Indiana 91.6 93.7 2.2 * Iowa 96.2 96.6 0.4 Kansas 94.3 93.9 -0.4 Kentucky 88.1 92.3 4.2 * Louisiana 89.7 91.1 1.4 Maine 93.4 96.5 3.1 * Maryland 95.7 96.7 1.0 Massachusetts 95.9 95.7 -0.2 Michigan 92.8 95.0 2.1 * Minnesota 95.8 97.1 1.3 Mississippi 82.4 87.5 5.2 * Missouri 91.5 95.3 3.9 * Montana 91.0 94.3 3.3 * Nebraska 95.7 96.0 0.3 Nevada 90.4 93.5 3.1 * New Hampshire 94.3 96.1 1.8 New Jersey 94.8 93.6
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-4.pdf
  • report includes monthly data on switched interstate telephone traffic as reflected in the NECA calculations of carrier common line (CCL) access minutes of use from January 1994 through December 1996. Table 4.1 shows the latest available figures on minutes of use for interstate traffic for the total industry as reported by NECA, derived from the Common Line earned revenues. Tables 4.2 and 4.3 show the figures for large (Tier 1) and small (non-Tier 1) companies, respectively. These 1 figures do not include the minutes from the closed end of WATS or 800/888 calls. Similar monthly data, extending back to mid-1985, are contained in earlier editions of this report. These are summarized in Table 4.4 on a quarterly basis. Table 4.5 summarizes
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-5.pdf
  • lines pay a fixed charge per presubscribed line per month. Table 5.15 shows the monthly charges per presubscribed line, the number of lines used as the basis for billings, and the total billings to interexchange carriers. TABLE 5.1 ANNUAL RATES OF CHANGE FOR VARIOUS PRICE INDEXES * 1935-1996 1986 - 1996 CPI all items 4.1% 3.7% CPI all services 4.5 4.2 CPI telephone services 2.0 0.7 CPI major categories: - food & beverages ** 3.5 - housing ** 3.3 - apparel & upkeep 3.1 2.2 - transportation 3.9 3.4 - medical care 5.2 6.5 - entertainment ** 3.6 - other goods & services ** 5.9 CPI public transportation 5.0 4.5 CPI piped gas 3.5 0.7 CPI electricity 2.4 1.8 CPI sewer
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-6.pdf
  • 83.8 94.4 10.7 * Arizona 88.8 91.0 2.2 Arkansas 88.2 88.2 0.1 California 91.7 95.3 3.6 * Colorado 94.4 95.8 1.4 Connecticut 95.5 96.2 0.7 Delaware 95.0 96.8 1.8 District of Columbia 94.7 90.6 -4.1 ** Florida 85.5 92.2 6.7 * Georgia 88.9 92.2 3.3 Hawaii 94.6 96.1 1.5 Idaho 89.5 93.4 3.9 Illinois 95.0 93.3 -1.7 Indiana 90.3 94.5 4.2 * Iowa 95.4 97.3 1.9 Kansas 94.9 93.2 -1.7 Kentucky 86.9 93.6 6.7 * Louisiana 88.9 91.7 2.7 Maine 90.7 97.7 7.0 * Maryland 96.3 96.9 0.6 Massachusetts 94.3 94.0 -0.3 Michigan 93.8 95.3 1.5 Minnesota 96.4 97.7 1.3 Mississippi 82.4 89.3 6.9 * Missouri 92.1 93.6 1.5 Montana 92.8 93.9 1.1 Nebraska 94.0 96.7 2.7 Nevada 89.4 90.7 1.3
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-7.pdf
  • CHANGES IN MAJOR PRICE INDEXES GDP Chain-type CPI: CPI: Price Index All Items Telephone Services 1978 7.2% 9.0% 0.9% 1979 8.6 13.3 0.7 1980 9.2 12.5 4.6 1981 9.4 8.9 11.7 1982 6.2 3.8 7.2 1983 4.3 3.8 3.6 1984 3.7 3.9 9.2 1985 3.6 3.8 4.7 1986 2.5 1.1 2.7 1987 3.1 4.4 -1.3 1988 3.6 4.4 1.3 1989 4.2 4.6 -0.3 1990 4.3 6.1 -0.4 1991 4.0 3.1 3.5 1992 2.8 2.9 -0.3 1993 2.6 2.7 1.8 1994 2.3 2.7 0.7 1995 2.5 2.5 1.2 1996 2.3 3.0 1.5 1997 1.8 1.7 0.2 Sources: Bureau of Labor Statistics and Bureau of Economic Analysis -5 0 5 10 15 Percent Change from Prior Year 1978 1980 1982 1984 1986 1988
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-8.pdf
  • 1.8 77.9 FOURTH QUARTER 77.4 1.6 79.1 TOTAL 1990 300.4 7.1 307.4 1991FIRST QUARTER 77.7 1.5 79.2 SECOND QUARTER 80.4 1.5 81.9 THIRD QUARTER 81.2 1.4 82.6 FOURTH QUARTER 83.0 1.4 84.4 TOTAL 1991 322.2 5.8 328.0 1992FIRST QUARTER 84.5 1.2 85.6 SECOND QUARTER 85.4 1.1 86.5 THIRD QUARTER 86.8 1.0 87.9 FOURTH QUARTER 88.8 1.0 89.8 TOTAL 1992 345.5 4.2 349.7 8 - 7 TABLE 8.4 INTERSTATE SWITCHED PREMIUM AND NON-PREMIUM ACCESS MINUTES (MINUTES SHOWN IN BILLIONS) PREMIUM NON-PREMIUM TOTAL MINUTES MINUTES MINUTES 1993FIRST QUARTER 89.8 0.9 90.6 SECOND QUARTER 90.4 0.8 91.2 THIRD QUARTER 92.9 0.7 93.6 FOURTH QUARTER 95.2 0.6 95.9 TOTAL 1993 368.3 3.0 371.2 1994FIRST QUARTER 98.1 0.6 98.7 SECOND QUARTER 97.4 0.5 97.9 THIRD QUARTER
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-9.pdf
  • AND BUSINESS CUSTOMERS Percent Installation Commitments Met 98.6 99.7 98.7 97.6 99.1 99.2 97.3 98.1 98.9 Residence 99.1 99.7 98.8 98.5 99.2 99.3 97.8 98.5 99.1 Business 96.7 99.4 98.3 95.7 98.9 98.6 94.6 95.9 97.9 Average Installation Interval (days) 3.0 1.6 NA 6.7 2.7 1.4 1.9 3.1 2.9 Residence 2.6 1.4 NA 5.4 2.3 1.3 1.3 2.9 2.5 Business 4.2 3.3 NA 7.4 4.2 1.7 3.4 4.1 4.9 Initial Trouble Reports per Thousand Lines 226.4 242.1 289.1 323.6 156.8 214.3 184.8 198.0 242.7 Total MSA 224.6 245.6 284.4 335.5 155.6 218.3 183.5 187.0 NA Total Non MSA 245.6 200.1 308.2 247.2 181.9 222.1 189.3 226.2 NA Total Residence 279.2 280.5 322.2 373.0 194.5 258.7 208.4 214.6 NA Total Business 119.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-0.pdf
  • 5.1 Rural Health Care Funding Commitments by Type of Provider ..............................Table 5.3 Rural Health Care Funding Commitments by Type of Service Provider ..................Table 5.4 Schools and Libraries Fund Disbursements by Service Provider Type .....................Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant .........Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ............Table 4.2 Schools and Libraries Mechanism - Net Revenue by State ......................................Table 4.4 State Code Reference .............................................................................................Table 8.2 Study Area Waiver Limitations ­ USF ­ Applied in 2000 .................................Table 3.4 Study Area Waiver Limitations ­ USF ­ Ended in 2000 ..................................Table 3.3 Subscribership ­ Effect of Do Not Disconnect Policies in Place for 60 Months ........Table 6.15 Subscribership ­ Effect of Do
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-4.pdf
  • schools, school districts, and other consortia. USAC submitted the list of schools and libraries to which SLD issued funding commitment letters as of October 25, 1999. As of that date, SLD had issued funding letters committing $1.722 billion of support. (As of November 22, 1999, $1.927 billion had been committed, but the underlying data used to generate tables 4.1 and 4.2 were not immediately available.)6 Table 4.1a summarizes the first funding period commitments (January 1, 1998 through June 30, 1999) by state and by type of applicant. Table 4.1b summarizes the second funding period commitments (July 1, 1999 through June 30, 2000) by state and by type of applicant. The complete lists of funding commitments are too lengthy to list, but
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-7.pdf
  • CHANGES IN MAJOR PRICE INDEXES GDP Chain-type CPI: CPI: Price Index All Items Telephone Services 1978 7.2% 9.0% 0.8% 1979 8.6 13.3 0.8 1980 9.2 12.5 4.4 1981 9.4 8.9 11.8 1982 6.2 3.8 7.2 1983 4.3 3.8 3.6 1984 3.7 3.9 9.2 1985 3.6 3.8 4.7 1986 2.5 1.1 2.7 1987 3.1 4.4 -1.3 1988 3.6 4.4 1.3 1989 4.2 4.6 -0.3 1990 4.3 6.1 -0.4 1991 4.0 3.1 3.5 1992 2.8 2.9 -0.3 1993 2.6 2.7 1.8 1994 2.3 2.7 0.7 1995 2.5 2.5 1.2 1996 1.9 3.3 2.1 1997 1.9 1.7 0.2 1998 1.0 1.6 0.3* Sources: Bureau of Labor Statistics and Bureau of Economic Analysis * The CPI telephone service index was revised in December of 1997.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-9.pdf
  • 98.3 99.1 98.7 98.1 99.0 99.0 97.8 98.0 98.8 Residence 98.4 99.2 98.9 98.5 99.0 99.1 98.3 98.3 99.0 Business 97.1 98.3 97.5 96.0 98.7 98.1 94.3 95.6 97.8 Average Installation Interval (days) 2.2 1.6 0.7 3.1 2.2 0.7 1.3 2.8 2.9 Residence 2.0 1.5 0.6 2.9 1.9 0.7 0.7 2.6 2.5 Business 3.5 2.6 1.4 5.3 3.4 0.7 3.4 4.2 5.1 Initial Trouble Reports per Thousand Lines 218.9 178.1 277.8 221.6 126.3 244.3 191.2 201.0 222.6 Total MSA 217.1 179.5 263.5 216.9 126.0 245.0 186.3 191.7 212.8 Total Non MSA 238.7 159.9 360.1 265.0 132.7 240.8 208.9 224.1 234.8 Total Residence 281.6 216.3 313.0 269.9 153.8 296.9 221.2 222.8 254.1 Total Business 103.3 112.8 195.8 131.4 79.0 129.2 122.0 143.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-0.pdf
  • Table 11.1 Revenues - Net .............................................................................................. Table 11.7 Rural Health Care Funding Commitments .......................................................... Table 5.1 Schools and Libraries Fund Disbursements by Service Provider Type................Table 4.3 Schools and Libraries Fund Disbursements to Service Providers by Type..........Table 4.4 Schools and Libraries Funding Commitments by State and Type of Applicant..Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service......Table 4.2 Schools and Libraries Mechanism - Net Revenue by State..................................Table 4.6 Schools and Libraries Program Fund Size Projections.........................................Table 4.5 State Code Reference........................................................................................... Table 8.21 Subscribership - United States ............................................................................ Table 6.1 Switch Downtime and Trunk Blocking ............................................................... Table 9.2 Switch Downtime Causes .................................................................................... Table 9.3 Switching Systems ............................................................................................. Table 10.1 Taxes - Federal Income ...................................................................................... Table 11.11 Taxes - Total Other
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-1.pdf
  • 0.1 0.2 58.0 49.2 107.2 8,495.1 9,441.117,936.2 Total per minute access charges 25.9 0.1 26.0 0.1 0.1 0.2 128.1 49.2 177.3 9,007.9 9,441.118,449.0 24Local private line & special access 2.1 * 2.1 10.9 38.4 49.3 1,157.7 4,697.0 5,854.8 25Pay telephone compensation from toll carriers 0.6 0.6 1.2 1.7 1.3 3.0 204.2 221.7 425.9 26Other local telecommunications service revenues 3.9 3.9 4.2 10.9 15.2 351.6 81.2 432.8 27Universal service support receipts 5.9 1.2 7.1 385.1 1,020.9 1,406.1 Total fixed local service provided for resale 33.9 1.2 35.1 0.1 0.1 0.2 167.5 101.2 268.7 12,404.216,802.229,206.5 Mobile service: 28Wireless telephony, paging messaging, and other mobile 2,177.7 85.8 2,263.5 482.7 81.7 564.4 29.4 * 29.4 2,876.8 167.8 3,044.6 service monthly, activation, and message charges except
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-4.pdf
  • of May 10, 1999 is available at the FCC's web site.3 Table 4.1 summarizes the Schools and Libraries commitments by state and by type of applicant. There were four types of applicants: libraries (or library consortia), schools, school districts, and other consortia. Table 4.1 also shows, by state, the number of funding commitments made to each type of applicant. Table 4.2 is based on the same data as table 4.1, and shows, on a state by state basis, funding commitments disaggregated into the three types of services: Internet access, telecommunications and dedicated access, and internal connections. The table also reports the weighted average discount that applicants in each state received for all services. The Schools and Libraries Division also supplied information
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-7.pdf
  • CHANGES IN MAJOR PRICE INDEXES GDP Chain-type CPI: CPI: Price Index All Items Telephone Services 1978 7.2% 9.0% 0.8% 1979 8.6 13.3 0.8 1980 9.2 12.5 4.4 1981 9.4 8.9 11.8 1982 6.2 3.8 7.2 1983 4.3 3.8 3.6 1984 3.7 3.9 9.2 1985 3.6 3.8 4.7 1986 2.5 1.1 2.7 1987 3.1 4.4 -1.3 1988 3.6 4.4 1.3 1989 4.2 4.6 -0.3 1990 4.3 6.1 -0.4 1991 4.0 3.1 3.5 1992 2.8 2.9 -0.3 1993 2.6 2.7 1.8 1994 2.3 2.7 0.7 1995 2.5 2.5 1.2 1996 1.9 3.3 2.1 1997 1.9 1.7 0.2 1998 1.0** 1.6 0.3* Sources: Bureau of Labor Statistics and Bureau of Economic Analysis * The CPI telephone service index was revised in December of 1997.
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-8.pdf
  • 1.8 77.9 FOURTH QUARTER 77.4 1.6 79.1 TOTAL 1990 300.4 7.1 307.4 1991FIRST QUARTER 77.7 1.5 79.2 SECOND QUARTER 80.4 1.5 81.9 THIRD QUARTER 81.2 1.4 82.6 FOURTH QUARTER 83.0 1.4 84.4 TOTAL 1991 322.2 5.8 328.0 1992FIRST QUARTER 84.5 1.2 85.6 SECOND QUARTER 85.4 1.1 86.5 THIRD QUARTER 86.8 1.0 87.9 FOURTH QUARTER 88.8 1.0 89.8 TOTAL 1992 345.5 4.2 349.7 8 - 7 TABLE 8.4 INTERSTATE SWITCHED PREMIUM AND NON-PREMIUM ACCESS MINUTES (MINUTES SHOWN IN BILLIONS) PREMIUM NON-PREMIUM TOTAL MINUTES MINUTES MINUTES 1993FIRST QUARTER 89.8 0.9 90.6 SECOND QUARTER 90.4 0.8 91.2 THIRD QUARTER 92.9 0.7 93.6 FOURTH QUARTER 95.2 0.6 95.9 TOTAL 1993 368.3 3.0 371.2 1994FIRST QUARTER 98.1 0.6 98.7 SECOND QUARTER 97.4 0.5 97.9 THIRD QUARTER
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-9.pdf
  • 1144.8 1221.4 561.7 10. Traffic Overload 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 11. Environmental 0.0 0.0 0.0 0.0 0.0 57.0 0.0 38.1 78.6 12. External Power Failure 0.0 141.2 330.2 134.8 0.0 0.0 1151.0 59.2 111.0 13. Massive Line Outage 0.0 0.0 0.0 0.0 0.0 0.0 0.0 12.3 234.8 14. Remote 0.0 0.0 19.6 0.0 0.0 0.0 4.2 0.0 0.0 15. Other/Unknown 0.0 1.8 0.0 919.8 5.6 0.0 388.7 0.0 135.9 Please refer to text for notes and data qualifications 9 - 14 Table 9.4: Company Comparision -- 1998 Customer Perception Surveys Company Ameritech Bell Atlantic BellSouth NYNEXPacific SBCUS West GTE Percentage of Customers Dissatisfied Installations: Residential 7.71 3.86 6.84 4.42 7.15 4.98 4.77 7.39 Small Business 10.83
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs00-0.pdf
  • 1.7 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care ­ Net Revenue by State ....................................................Table 5.2 Schools and Libraries Fund Disbursements by Service Provider Type ................... Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant ..... Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ......... Table 4.2 Schools and Libraries Mechanism - Net Revenue by State .....................................Table 4.4 State Code Reference ...............................................................................................Table 8.13 Study Area Waiver Limitations - HCL - Applied to 2000 .............................. Table 3.4 Study Area Waiver Limitations - HCL - Ended in 2000 ............................... Table 3.3 Subscribership - Effect of Do Not Disconnect Policies in Place for 60 Months ..... Table 6.15 Subscribership -
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs01-0.pdf
  • 11.7 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care - Net Revenue by State ....................................................Table 5.2 Schools and Libraries Fund Disbursements by Service Provider Type ................... Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant ..... Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ......... Table 4.2 Schools and Libraries Mechanism - Net Revenue by State ..................................... Table 4.4 State Code Reference ...............................................................................................Table 8.13 Subscribership - United States ................................................................................Table 6.1 Switch Downtime and Trunk Blocking ................................................................... Table 9.2 Switch Downtime Causes .......................................................................................Table 9.3 Switching Systems ..................................................................................................Table 10.1 Taxes ................................................................................................................Table 11.11 Telecommunications Revenues by Type of Carrier ............................................. Table 1.1 Transmission Systems .............................................................................................Table 10.2 Universal Service Program Requirements
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs02-0.pdf
  • Table 5.1 Rural Health Care - Net Dollar Flow by State ............................................... Table 5.3 Rural Health Care - Service Speeds Acquired .............................................. Table 5.2 Schools and Libraries Disbursements by Service Provider Type .......................... Table 4.3 Schools and Libraries Commitments & Disbursements by State & Applicant Type Table 4.1 Schools and Libraries Commitments & Disbursements by State & Service Type ...Table 4.2 5 Index of Tables and Charts Schools and Libraries Commitments & Disbursements per Student by State ........ Table 4.4 Schools and Libraries Mechanism - Net Dollar Flow by State ................................Table 4.5 State Code Reference ............................................................................................... Table 8.13 Subscribership - United States ................................................................................ Table 6.1 Switch Downtime and Trunk Blocking ................................................................... Table 9.2 Switch Downtime Causes ....................................................................................... Table 9.3 Switching Systems
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual00.pdf
  • Years Number of Reports 1996 1997 1998 1999 2000 Composite Verizon Bell South SBC Qwest Sprint Initial Trouble Reports per Thousand Lines Chart 3 Percent Dissatisfied -- Residential Installations (Using Company Provided Composites) 1996 1997 1998 1999 2000 BellSouth 5.2 5.7 6.8 9.2 12.8 Qwest 9.5 4.9 4.9 7.3 7.4 SBC Ameritech 3.5 5.4 7.6 7.7 16.4 SBC Pacific 3.1 4.2 7.2 10.8 13.5 SBC Southwestern 5.8 5.5 5.0 5.7 6.8 Verizon GTE 7.5 7.8 7.4 7.4 4.4 Verizon North 14.1 (Combined with Verizon South) Verizon South 8.5 7.2 4.1 5.3 5.2 0 5 10 15 Years Percent Dissatisfied 1996 1997 1998 1999 2000 Composite Verizon Bell South SBC Qwest Residential Installation Dissatisfaction Incumbent BOCs Chart 4 Percent Installation Commitments Met
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual01.pdf
  • Lines 0.0 50.0 100.0 150.0 200.0 250.0 300.0 350.0 1996 1997 1998 1999 2000 2001 Years Num ber o f Rep orts Composite Verizon BellSouth SBC Qwest Sprint 9 1996 1997 1998 1999 2000 2001 BellSouth 5.2 5.7 6.8 9.2 12.8 11.2 Qwest 9.5 4.9 4.9 7.3 7.4 6.4 SBC Ameritech 3.5 5.4 7.6 7.7 16.4 15.5 SBC Pacific 3.1 4.2 7.2 10.8 13.5 8.8 SBC Southwestern 5.8 5.5 5.0 5.7 6.8 8.0 Verizon GTE 7.5 7.8 7.4 7.4 4.4 4.8 Verizon North 14.1 (Combined with Verizon South) Verizon South 8.5 7.2 4.1 5.3 5.2 4.8 Chart 3 Percent Dissatisfied -- Residential Installations (Using Company Provided Composites) Residential Installation Dissatisfaction Incumbent BOCs 0.0 2.0 4.0 6.0 8.0 10.0 12.0 14.0 1996
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual02.pdf
  • 250.0 300.0 350.0 1997 1998 1999 2000 2001 2002 Years Number o f Repo rts Weighted Verizon Avg. BellSouth Weighted SBC Avg. Qwest Sprint Weighted Composite* 9 ARMIS 43-06 Report 1997 1998 1999 2000 2001 2002 BellSouth 5.7 6.8 9.2 12.8 11.2 10.3 Qwest 4.9 4.9 7.3 7.4 6.4 7.0 SBC Ameritech 5.4 7.6 7.7 16.4 15.5 10.7 SBC Pacific 4.2 7.2 10.8 13.5 8.8 6.4 SBC Southwestern 5.5 5.0 5.7 6.8 8.0 8.1 Verizon GTE 7.8 7.4 7.4 4.4 4.8 4.1 Verizon North (Combined with Verizon South) Verizon South 7.2 4.1 5.3 5.2 4.8 5.2 Weighted Composite* 6.0 5.9 7.4 9.2 8.2 7.2 * Industry weighted composite is calculated using access line counts. Percent Dissatisfied -- BOC Residential Installations (Using
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual03.pdf
  • Price-Cap Carriers 0.0 10.0 20.0 30.0 40.0 50.0 60.0 1998 1999 2000 2001 2002 2003 Years Interval in H ours Weighted BOC/Sprint Composite* Alltel Corp. Cincinnati Bell Citizens Century Tel. Weighted Small Co.Composite* Iowa Telecom Valor 18 Percentage of Switches with Downtime (Using Company Provided Composites) ARMIS 43-05 Report 1998 1999 2000 2001 2002 2003 BellSouth 8.9 8.3 6.4 5.9 4.2 2.5 Qwest 65.1 77.5 42.1 36.0 18.8 11.1 SBC Ameritech 37.3 23.3 3.7 3.4 4.5 1.7 SBC Pacific 13.7 16.2 10.1 15.4 2.3 3.3 SBC Southwestern 15.9 17.2 12.0 10.3 4.3 3.9 SBC SNET 12.9 7.9 28.8 42.3 4.4 0.6 Verizon GTE 7.7 3.4 2.9 1.6 1.3 2.7 Verizon North (Combined with Verizon South) Verizon South 10.0 4.7 8.6 5.6
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual98.pdf
  • 98.3 99.1 98.7 98.1 99.0 99.0 97.8 98.0 98.8 Residence 98.4 99.2 98.9 98.5 99.0 99.1 98.3 98.3 99.0 Business 97.1 98.3 97.5 96.0 98.7 98.1 94.3 95.6 97.8 Average Installation Interval (days) 2.2 1.6 0.7 3.1 2.2 0.7 1.3 2.8 2.9 Residence 2.0 1.5 0.6 2.9 1.9 0.7 0.7 2.6 2.5 Business 3.5 2.6 1.4 5.3 3.4 0.7 3.4 4.2 5.1 Initial Trouble Reports per Thousand Lines 218.9 178.1 277.8 221.6 126.3 244.3 191.2 201.0 222.6 Total MSA 217.1 179.5 263.5 216.9 126.0 245.0 186.3 191.7 212.8 Total Non MSA 238.7 159.9 360.1 265.0 132.7 240.8 208.9 224.1 234.8 Total Residence 281.6 216.3 313.0 269.9 153.8 296.9 221.2 222.8 254.1 Total Business 103.3 112.8 195.8 131.4 79.0 129.2 122.0 143.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/00socc.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/01socc.pdf
  • . . . . . . . . . . . . . . . . . . . . 161 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . . . .165 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2001. . . . . . . . . . . . . . . . . . . . . 166 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/02socc.pdf
  • . . . . . . . . . . . . . . . . . . . . 165 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . . 169 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2002. . . . . . . . . . . . . . . . . . . . 170 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/02socc.pdf
  • 260.4 6.2 DC Florida 7,174.8 518.7 6,656.1 4,508.7 2,147.4 959.4 217.0 876.3 2,052.7 94.7 FL Georgia 3,560.6 206.7 3,353.9 2,327.4 1,026.5 366.4 119.7 495.2 981.3 45.2 GA Hawaii 518.8 76.1 442.7 302.3 140.4 64.4 19.1 50.3 133.8 6.5 HI Idaho 476.8 23.3 453.5 279.3 174.1 68.4 25.9 69.4 163.7 10.4 ID Illinois 4,319.8 270.5 4,049.4 2,977.7 1,071.7 395.2 151.0 458.0 1,004.2 67.4 IL Indiana 2,170.4 157.5 2,012.9 1,433.6 579.4 260.2 66.3 217.7 544.2 35.1 IN Iowa 623.5 28.9 594.5 390.7 203.8 59.9 34.9 96.8 191.6 12.2 IA Kansas 931.1 109.4 821.7 551.8 269.9 86.3 31.7 128.2 246.2 23.7 KS Kentucky 1,043.1 43.4 999.6 741.1 258.5 113.0 39.0 93.7 245.7 12.8 KY Louisiana 1,693.8 65.0 1,628.8 1,216.7 412.1 190.0 51.1 147.8 388.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/03socc.pdf
  • . . . . . . . . . . . . . . . . . . 159 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . . . . . . 163 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2003. . . . . . . . . . . . . . . . . . . . . . 164 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/95socc.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 203 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/95socc.pdf
  • 1,658.2 53.3 1,605.0 1,182.2 422.8 213.9 131.6 56.3 401.8 20.9 TN TEXAS 6,568.0 370.6 6,197.3 4,691.4 1,506.0 743.1 444.6 275.7 1,463.5 42.5 TX UTAH 560.4 17.6 542.9 379.6 163.3 65.7 67.8 24.4 157.9 5.4 UT VERMONT 213.5 5.7 207.8 134.2 73.6 24.2 40.8 6.2 71.2 2.4 VT VIRGINIA 2,608.2 288.8 2,319.4 1,674.8 644.5 295.5 206.8 100.8 603.1 41.4 VA WASHINGTON 2,004.2 102.0 1,902.3 1,380.4 521.8 225.6 208.1 58.2 491.9 30.0 WA WEST VIRGINIA 581.2 41.3 539.9 389.0 150.9 91.1 41.8 13.0 145.9 5.0 WV WISCONSIN 1,410.3 53.4 1,356.9 1,027.4 329.5 149.4 121.6 46.4 317.4 12.1 WI WYOMING 149.8 3.5 146.2 102.0 44.2 14.6 23.2 4.8 42.6 1.6 WY PUERTO RICO 1,034.5 41.9 992.6 775.8 216.8 113.7 63.6 26.6 203.9 12.8 PR
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/96socc.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/97socc.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1997. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/98SOCC.PDF
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 189 TABLE 4.2-INTERNATIONAL PRIVATE LINE SERVICES OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/99socc.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 Table 4.2 - Access Revenues, 1984 -1999. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/prelim02socc.pdf
  • 260.4 6.2 DC Florida 7,174.8 518.7 6,656.1 4,508.7 2,147.4 959.5 217.0 876.3 2,052.8 94.7 FL Georgia 3,560.6 206.7 3,353.9 2,327.3 1,026.6 366.4 119.8 495.3 981.5 45.1 GA Hawaii 518.8 76.1 442.7 302.3 140.4 64.4 19.1 50.3 133.8 6.5 HI Idaho 112.9 5.2 107.7 56.6 51.1 30.6 4.9 14.0 49.5 1.5 ID Illinois 4,319.8 270.5 4,049.4 2,977.7 1,071.7 395.2 151.0 458.0 1,004.2 67.4 IL Indiana 2,170.4 157.5 2,012.9 1,433.7 579.3 260.1 66.3 217.7 544.1 35.1 IN Iowa 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 IA Kansas 931.1 109.4 821.7 554.2 267.5 85.4 31.4 127.6 244.4 23.1 KS Kentucky 1,043.1 43.4 999.6 741.1 258.5 113.0 39.0 93.7 245.7 12.8 KY Louisiana 1,693.8 65.0 1,628.8 1,216.7 412.1 190.0 51.1 147.8 388.9
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/prelim02socc.pdf
  • 35.1 IN Iowa 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 IA Kansas 931.1 109.4 821.7 554.2 267.5 85.4 31.4 127.6 244.4 23.1 KS Kentucky 1,043.1 43.4 999.6 741.1 258.5 113.0 39.0 93.7 245.7 12.8 KY Louisiana 1,693.8 65.0 1,628.8 1,216.7 412.1 190.0 51.1 147.8 388.9 23.2 LA Maine 490.7 18.6 472.2 329.5 142.6 59.1 21.8 57.5 138.4 4.2 ME Maryland 2,321.8 153.4 2,168.5 1,471.1 697.3 289.1 85.7 297.8 672.6 24.8 MD Massachusetts 2,623.2 136.1 2,487.2 1,606.5 880.7 344.0 87.9 423.1 855.0 25.7 MA Michigan 3,568.9 196.7 3,372.2 2,527.2 845.0 354.0 107.7 351.6 813.3 31.7 MI Minnesota 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 MN Mississippi 1,137.5 22.0 1,115.4 867.6 247.9 119.0 41.9 74.4 235.3 12.7
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc00idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc01idx.pdf
  • . . . . . . . . . . . . . . . . . . . . 161 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . . . .165 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2001. . . . . . . . . . . . . . . . . . . . . 166 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc02idx.pdf
  • . . . . . . . . . . . . . . . . . . . . 165 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . . 169 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2002. . . . . . . . . . . . . . . . . . . . 170 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc03idx.pdf
  • . . . . . . . . . . . . . . . . . . 159 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . . . . . . 163 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2003. . . . . . . . . . . . . . . . . . . . . . 164 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc04idx.pdf
  • . . . . . . . . . . . . . . . . . . .111 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . . . . . . 115 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2004. . . . . . . . . . . . . . . . . . . . . . 116 Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc05idx.pdf
  • . . . . . . . .. . . . . . Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2006. . . . . . . . . . . . . . . . . . . . . . . . . . . . . Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006. . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc06_07idx.pdf
  • . . . .. . . . . . . . 202 208 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2008. . . . . . . . . . . . . . . . . . . . . . . . . . . . . Table 4.3 -Toll Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008. . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc93idx.pdf
  • 31, 1993. . . . . . . . . . . . 180 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR 1993. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR 1993. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 TABLE 4.3-INTERNATIONAL EXCHANGE TELEX SERVICE OF THE DOMESTIC UNITED STATES FOR 1993. . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc94idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 215 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1994. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc95idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 203 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc96idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc97idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 191 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1997. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc98idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 189 TABLE 4.2-INTERNATIONAL PRIVATE LINE SERVICES OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc99idx.pdf
  • . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 Table 4.2 - Access Revenues, 1984 -1999. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
• http://www.fcc.gov/Bureaus/Common_Carrier/Reports/scard98.pdf
  • Forms. Note 1: The FCC has been advised that this company filed for bankruptcy. Companies Served More Than 50 Complaints in 1997 APPENDIX A Long Distance Telephone Companies Complaints Revenue Complaint Ranked by Complaint Index (Continued) Served (Millions) Index 40 COMMON CARRIER SCORECARD REPORT Billing Agents Ranked by Complaints Billing Concepts Corp. 6,059 2,011 3.0 OAN Services, Inc. 3,477 827 4.2 Integretel 1,522 390 3.9 International Telemedia Associates 953 124 7.7 HOLD Billing Services 553 127 4.4 Telephone Billing Service 338 Long Distance Billing Company, Inc. 237 Crown Communications 121 American Telnet, Inc. 112 Federal TransTel, Inc.3 75 Local Telephone Companies Ranked by Complaint Index Bell Atlantic 7,588 24,936 0.30 U S WEST 2,504 10,022 0.25 SBC 4,590 18,756 0.24 Ameritech
• http://www.fcc.gov/Bureaus/Common_Carrier/in-region_applications/bellsouth_sc/bssccom.html
  • here in a single zip file: [5]bsscrpl.zip (938 KB, 31 files, 2.9 MB unzipped). See the [6]Reply Comments Table below for the names of the parties who submitted disks and their associated files. Comments 10/20/97 18 comments were filed electronically with the FCC for this proceeding and are provided here in a single zip file: [7]bssccom.zip (1 MB, 45 files, 4.2 MB unzipped). See the [8]Comments Table below for the names of the parties who submitted disks and their associated files. To download a zip file: click on the highlighted file name above, then use your browser's normal save function to save the zip file to your computer. Once it's on your system, use an [9]unzip program to unzip the downloaded
• http://www.fcc.gov/Bureaus/Common_Carrier/in-region_applications/sbc/sbcbrief.pdf http://www.fcc.gov/Bureaus/Common_Carrier/in-region_applications/sbc/sbcbrief.wp
  • These include those set out in the Sprint Southwestern Bell, April 11, 1997, Oklahoma -32- Agreement, which gives Sprint (and therefore Brooks Fiber) access to, among other things, "all vertical features that the switch is capable of providing, including . . . any technically feasible customized routing functions." Sprint Agreement, Attach. 6 at § 5.1; but see Sprint Agreement § 4.2 (calling for revision of terms in accordance with appellate decisions regarding implementation of Local Interconnection Order). Checklist Item (7): Nondiscriminatory Access to 911, E911, Directory Assistance, and Operator Call Completion Services Section 271(c)(2)(B)(vii) directs SWBT to provide nondiscriminatory access to 911 and E911 services, directory assistance ("DA") services, and operator call completion services. 1. SWBT's Statement satisfies these obligations. The
• http://www.fcc.gov/Bureaus/Engineering_Technology/Documents/bulletins/oet56/oet56e4.pdf
  • TheFCC'sguidelinesarebasedonrecommendedexposurecriteriaissuedbythe NCRPandANSI/IEEE.TheNCRPexposureguidelinesaresimilartotheANSI/IEEE1992 guidelinesexceptfordifferencesinrecommendedexposurelevelsatthelowerfrequencies andhigherfrequenciesoftheRFspectrum.BothANSI/IEEEandNCRPrecommendtwo differenttiersofexposurelimits.TheNCRPdesignatesonetierforoccupationalexposure andtheotherforexposureofthegeneralpopulationwhileANSI/IEEEdesignatesexposure tiersintermsof"environments,"onefor"controlled"environmentsandtheotherfor "uncontrolled"environments.Overabroadrangeoffrequencies,NCRPexposurelimitsfor thepublicaregenerallyone-fifththoseforworkersintermsofpowerdensity.9 TheNCRPandANSI/IEEEexposurecriteriaidentifythesamethresholdlevelat whichharmfulbiologicaleffectsmayoccur,andthevaluesforMaximumPermissible Exposure(MPE)recommendedforelectricandmagneticfieldstrengthandpowerdensityin 8TheTelecommunicationsActof1996,enactedonFebruary8,1996,requiredthat:"Within180daysafterthe enactmentofthisAct,theCommissionshallcompleteactioninETDocket93-62toprescribeandmakeeffective rulesregardingtheenvironmentaleffectsofradiofrequencyemissions."SeeSection704(b)ofthe TelecommunicationsActof1996,Pub.L.No.104-104,110Stat.56(1996). 9 TheFCCadoptedlimitsforfieldstrengthandpowerdensitythatarebasedonSections17.4.1and17.4.2, andthetime-averagingprovisionsofSections17.4.1.1and17.4.3,of"BiologicalEffectsandExposureCriteriafor RadiofrequencyElectromagneticFields,"NCRPReportNo.86,forfrequenciesbetween300kHzand100GHz (Reference34).Withtheexceptionoflimitsonexposuretopowerdensityabove1500MHz,andlimitsforexposure tolowerfrequencymagneticfields,theseMPElimitsarealsobasedontheguidelinesdevelopedbytheIEEEand adoptedbyANSI.SeeSection4.1ofANSI/IEEEC95.1-1992,"SafetyLevelswithRespecttoHumanExposureto RadioFrequencyElectromagneticFields,3kHzto300GHz"(Reference3). 12 bothdocumentsarebasedonthisthresholdlevel.10Inaddition,boththeANSI/IEEEand NCRPguidelinesarefrequencydependent,basedonfindings(discussedearlier)thatwhole- bodyhumanabsorptionofRFenergyvarieswiththefrequencyoftheRFsignal.Themost restrictivelimitsonexposureareinthefrequencyrangeof30-300MHzwherethehuman bodyabsorbsRFenergymostefficientlywhenexposedinthefarfieldofanRFtransmitting source.AlthoughtheANSI/IEEEandNCRPguidelinesdifferathigherandlower frequencies,atfrequenciesusedbythemajorityofFCClicenseestheMPElimitsare essentiallythesameregardlessofwhetherANSI/IEEEorNCRPguidelinesareused. Mostradiofrequencysafetylimitsaredefinedintermsoftheelectricandmagnetic fieldstrengthsaswellasintermsofpowerdensity.Forlowerfrequencies,limitsaremore meaningfullyexpressedintermsofelectricandmagneticfieldstrengthvalues,andthe indicatedpowerdensitiesareactually"far-fieldequivalent"powerdensityvalues.Thelatter arelistedforcomparisonpurposesandbecausesomeinstrumentationusedformeasuringRF fieldsiscalibratedintermsoffar-fieldorplane-waveequivalentpowerdensity.Athigher frequencies,andwhenoneisactuallyinthe"farfield"ofaradiationsource,itisusuallyonly necessarytoevaluatepowerdensity.InthefarfieldofanRFtransmitterpowerdensityand fieldstrengtharerelatedbystandardmathematicalequations.11 TheexposurelimitsadoptedbytheFCCin1996expressedintermsofelectricand magneticfieldstrengthandpowerdensityfortransmittersoperatingatfrequenciesfrom300 kHzto100GHzareshowninTable1.TheFCCalsoadoptedlimitsforlocalized("partial body")absorptionintermsofSAR,showninTable2,thatapplytocertainportable transmittingdevicessuchashand-heldcellulartelephones.12 10 Theseexposurelimitsarebasedoncriteriaquantifiedintermsofspecificabsorptionrate(SAR).SARisa measureoftherateatwhichthebodyabsorbsRFenergy.BoththeANSI/IEEEandNCRPexposurecriteriaare basedonadeterminationthatpotentiallyharmfulbiologicaleffectscanoccuratanSARlevelof4W/kgasaveraged overthewhole-body.Appropriatesafetyfactorshavebeenincorporatedtoarriveatlimitsforbothwhole-body exposure(0.4W/kgfor"controlled"or"occupational"exposureand0.08W/kgfor"uncontrolled"or"general population"exposure,respectively)andforpartial-body(localizedSAR),suchasmightoccurintheheadoftheuser ofahand-heldcellulartelephone.ThenewMPElimitsaremoreconservativeinsomecasesthanthelimitsspecified byANSIin1982.However,thesemoreconservativelimitsdonotarisefromafundamentalchangeintheSAR thresholdforharm,butfromaprecautionarydesiretoaddanadditionalmarginofsafetyforexposureofthepublic orexposurein"uncontrolled'environments. 11 SeeOETBulletin65(Reference57)fordetails. 12TheseguidelinesarebasedonthoserecommendedbyANSI/IEEEandNCRP.SeeSections4.2.1and4.2.2 ofANSI/IEEEC95.1-1992andSection17.4.5ofNCRPReportNo.86.Forpurposesofevaluation,theFCChas designatedthesedevicesaseither"portable"or"mobile"dependingonhowtheyaretobeused.Portabledevicesare normallythoseusedwithin20centimetersofthebodyandmustbeevaluatedwithrespecttoSARlimits.Mobile devicesarenormallyused20centimetersormoreawayfromthebodyandcanbeevaluatedintermsofeitherSAR orfieldintensity.DetailedinformationonFCCrequirementsforevaluatingportableandmobiledevicescanbe foundinOETBulletin65andintheFCC'sRulesandRegulations,47CFR2.1091and2.1093. 13 TimeAveragingofExposure TheNCRPandANSI/IEEEexposurecriteriaandmostotherstandardsspecify "time-averaged"MPElimits.Thismeansthatitispermissibletoexceedtherecommended limitsforshortperiodsoftimeaslongastheaverageexposure(overtheappropriateperiod specified)doesnotexceedthelimit.Forexample,Table1showsthatforafrequencyof100 MHztherecommendedpowerdensitylimitis1mW/cm2withanaveragingtimeofsix minutes(anysix-minuteperiod)foroccupational/controlledexposure. Thetime-averagingconceptcanbeillustratedasfollowsforexposureinaworkplace environment.Thesumoftheproduct(orproducts)oftheactualexposurelevel(s)multiplied bytheactualtime(s)ofexposuremustnotbegreaterthantheallowed(average)exposure limittimesthespecifiedaveragingtime.Therefore,for100MHz,exposureat2mW/cm2 wouldbepermittedforthreeminutesinanysix-minuteperiodaslongasduringthe remainingthreeminutesofthesix-minuteperiodtheexposurewasatornear"zero"levelof exposure.Therefore,inthisexample: (2mW/cm2)X(3min.)+(0mW/cm2)X(3min.)=(1mW/cm2)X(6min.) Ofcourse,othercombinationsofpowerdensityandtimearepossible.Itisvery importanttorememberthattimeaveragingofexposureisonlynecessaryorrelevantfor situationswheretemporaryexposuresmightoccurthatareinexcessoftheabsolutelimitsfor powerdensityorfieldstrength.Thesesituationsusuallyonlyoccurinworkplace environmentswhereexposurecanbemonitoredandcontrolled.Forgeneral population/uncontrolledexposures,sayinaresidentialneighborhood,itisseldompossibleto havesufficientinformationorcontrolregardinghowlongpeopleareexposed,andaveraging ofexposureoverthedesignatedtimeperiod(30minutes)isnormallynotappropriate.For suchpublicexposuresituations,theMPElimitsnormallyapplyforcontinuousexposure.In otherwords,aslongastheabsolutelimitsarenotexceeded,indefiniteexposureisallowed. InducedandContactCurrents Inadditiontolimitsonfieldstrength,powerdensityandSAR,somestandardsforRF exposurehaveincorporatedlimitsforcurrentsinducedinthehumanbodybyRFfields.For example,the1992ANSI/IEEEstandard(Reference3),includesspecificrestrictionsthatapply to"induced"and"contact"currents(thelatter,whichappliesto"grasping"contact,ismore relatedtoshockandburnhazards).ThelimitsonRFcurrentsarebasedonexperimentaldata showingthatexcessiveSARlevelscanbecreatedinthebodyduetothepresenceofthese currents.Inits1996OrderadoptingnewRFexposureguidelinestheFCCdeclinedtoadopt limitsoninducedandcontactcurrentsdueprimarilytothedifficultyofreliablydetermining compliance,eitherbypredictionmethodsorbydirectmeasurement.However,theFCCmay reconsiderthisdecisioninthefuturebecauseofthedevelopmentofnewinstrumentationand analyticaltechniquesthatmaybemorereliableindicatorsofexposure. 14 Table1.FCCLimitsforMaximumPermissibleExposure(MPE) (A)LimitsforOccupational/ControlledExposure ______________________________________________________________________________ Frequency ElectricField MagneticField PowerDensityAveragingTime Range Strength(E) Strength(H) (S) E 2, H 2orS
• http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.txt http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://www.fcc.gov/Bureaus/Engineering_Technology/Notices/1996/fcc96317.pdf
  • 22 50.0 47.0 1417 346 1417 346 9.6 3.5 100.0 CA CHICO 12 15 3437.1 396.0 30475 570 29229 562 0.3 0.3 99.7 CA CHICO 24 4 1.0 564.0 23058 359 21026 347 0.6 3.4 100.0 CA CLOVIS 43 44 50.0 671.0 11710 935 11083 931 12.5 5.0 100.0 CA CONCORD 42 56 83.3 856.0 26830 6280 26656 6234 2.4 4.2 99.0 CA CORONA 52 15 167.3 896.0 18891 12437 18769 12125 8.3 1.5 96.3 CA COTATI 22 23 50.0 620.0 10454 1767 8448 1284 1.3 0.1 100.0 CA EL CENTRO 7 14 1637.1 389.0 23044 189 21853 189 0.0 0.0 100.0 CA EL CENTRO 9 18 1583.0 488.0 27713 229 26696 229 0.0 0.0 100.0 CA EUREKA 3 34 3874.8
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1996/fcc96326.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1996/fcc96326.txt
  • the RF safety standard developed by the Institute of Electrical and Electronic Engineers, Inc. (IEEE) and adopted by the American National Standards Institute (ANSI). See Section 4.1 of ANSI/IEEE C95.1-1992, "Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz". These guidelines are based on those recommended by ANSI/IEEE and NCRP. See Sections 4.2.1 and 4.2.2 2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 2 V.CONCLUSION.......................................................169 VI.ORDERING CLAUSES............................................170-172 VII.PROCEDURAL MATTERS............................................173 Final Regulatory Flexibility Analysis ..................................Appendix A Exposure Limits for ANSI 1982, ANSI/IEEE 1992 and NCRP ..............Appendix B Final Rules ......................................................Appendix C Commenting Parties ...............................................Appendix D I. INTRODUCTION 1. By this action, we are amending our rules to adopt new guidelines
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.wp
  • 0.1 0.2 92.1 CALOSANGELES 28 59 182.2 927.0 25452 12719 24863 12621 1.1 0.8 99.6 CALOSANGELES 34 35 70.3 896.0 22216 12586 21279 12427 0.5 1.0 99.7 CALOSANGELES 58 41 55.7 875.0 21665 12534 20290 12096 0.4 0.7 100.0 CAMERCED 51 38 129.4 680.0 21680 1288 20945 1275 0.0 0.0 99.9 CAMODESTO 19 18 238.2 573.0 26692 2695 26692 2748 4.2 1.4 98.3 CAMONTEREY 46 32 50.0 771.0 16201 718 15629 705 0.3 0.2 99.1 CAMONTEREY 67 31 50.0 701.0 14214 1413 12867 716 0.0 0.0 99.7 CANOVATO 68 47 124.2 431.0 20706 4165 18713 3674 0.1 0.0 99.6 CAOAKLAND 2 56 1000.0 479.0 35218 5937 36057 5970 0.0 0.0 92.9 CAONTARIO 46 47 69.9 927.0 17999 12158 17391 11983 0.2
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.txt http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.wp
  • 86 (1986). With the exception of the limits on exposure to power density above 1500 MHz and the limits for exposure to lower frequency magnetic fields, these MPE limits are also generally based on the guidelines contained in Section 4.1 of ANSI/IEEE C95.1-1992. We also adopted limits for localized ("partial body") absorption for certain portable transmitting devices based on Sections 4.2.1 and 4.2.2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 8 Federal Communications Commission FCC 97-303 20. The Electromagnetic Energy Association (EEA), U S WEST, Inc. and the Department of Defense (DOD) ask us to reconsider our decision not to adopt the ANSI/IEEE 1992 standard in its entirety.9 The National Association of Broadcasters (NAB) also supports this
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.txt http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.txt http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.wp
  • the applicable provisions of [Guide 65] and other standards and guides relevant to testing, inspection Federal Communications Commission FCC 98-338 41See Guide 65, clause 4.4(a) & (b). 42See Retlif comments at 3, Rockwell comments at 2, and Kenwood reply comments at 3. 43See ACIL comments at 3, CCL comments at 2, and Intertek comments at 4. 44See Guide 65, clause 4.2(a) & (o). 45See Guide 65, clause 4.4(b). 11 or other technical activities."41 Thus, TCBs must ensure that subcontractors, which perform their work under the direction of, and generally with compensation from, the TCB, are competent and in compliance. We do not interpret Guide 65 as requiring subcontractors to be Guide 25 accredited. We expect that as a result of our
• http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.doc http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.pdf http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.txt
  • 61.9 Satellite link unavailability for the worst-month % 0.0978 0.3316 0.9361 1.3177 Total link unavailable time for the worst-month minutes 42.8 145.2 421.8 577.1 10% of the unavailable time in the worst-month minutes 4.3 14.5 42.2 57.7 5% of the unavailable time in the worst-month minutes 2.1 7.26 21.1 28.9 2.86% of the unavailable time in the worst-month minutes 1.2 4.2 12.1 16.5 Rainy sky C/I for a 2.86% increase in link unavailability dB 24.2 22.9 25.0 22.3 APPENDIX H -- A METHOD OF CONVERTING PERCENTAGE OF UNAVAILABLE TIME INTO A CARRIER-TO-INTERFERENCE RATIO This appendix presents a method for determining the relationship between DBS service outage time and a DBS system's carrier-to-noise plus interference ratio (C/N+I). Specifically, this method can be
• http://www.fcc.gov/Bureaus/International/Orders/1997/fc97280d.pdf
  • Component Prices International International National Tariffed Country Transmission Switching Extension Component Price Argentina 6.7¢ 3.4¢ 22.0¢ 32.1¢ Australia 4.8¢ 1.9¢ 12.0¢ 18.7¢ Austria 8.1¢ 1.9¢ 21.4¢ 31.4¢ Bahamas 5.2¢ 1.9¢ 12.8¢ 19.9¢ Barbados 8.6¢ 3.4¢ Zero 12.0¢ Belgium 3.0¢ 1.9¢ 9.2¢ 14.1¢ Bermuda 4.5¢ 1.9¢ 3.5¢ 9.9¢ Brazil 6.6¢ 3.4¢ 17.8¢ 27.8¢ Chile 2.9¢ 3.4¢ 12.3¢ 18.6¢ China 8.7¢ 4.8¢ 4.2¢ 17.7¢ Colombia 5.1¢ 4.8¢ 8.6¢ 18.5¢ Costa Rica 3.3¢ 4.8¢ 2.2¢ 10.3¢ Czech Republic 8.1¢ 3.4¢ 7.5¢ 19.0¢ Denmark 5.9¢ 1.9¢ 6.6¢ 14.4¢ Dominican Republic 3.6¢ 4.8¢ 6.1¢ 14.5¢ Ecuador 2.9¢ 4.8¢ 2.6¢ 10.3¢ Egypt 10.4¢ 4.8¢ 2.0¢ 17.2¢ El Salvador 5.9¢ 4.8¢ 1.1¢ 11.8¢ France 2.9¢ 1.9¢ 12.7¢ 17.5¢ Germany 4.3¢ 1.9¢ 13.6¢ 19.8¢ Greece 5.2¢ 3.4¢ 14.4¢ 23.0¢
• http://www.fcc.gov/Bureaus/International/Orders/1997/fc97280e.pdf http://www.fcc.gov/Bureaus/International/Orders/1997/fc97280e.txt http://www.fcc.gov/Bureaus/International/Orders/1997/fc97280e.wp
  • 10.4¢ Poland 4.7¢ El Salvador 5.9¢ Portugal 4.6¢ France 2.9¢ Russia 5.4¢ Germany 4.3¢ Singapore 5.0¢ Greece 5.2¢ South Africa 5.2¢ Guatemala 3.1¢ Spain 4.8¢ Guyana 6.6¢ Sweden 3.6¢ Haiti 8.6¢ Switzerland 4.4¢ Honduras 3.1¢ Taiwan 5.7¢ Hong Kong 5.1¢ Thailand 4.0¢ Hungary 6.1¢ Trinidad 3.6¢ India 8.1¢ Turkey 5.4¢ Indonesia 6.8¢ U.A.E. 3.3¢ Ireland 2.7¢ United Kingdom 2.4¢ Israel 4.2¢ Uruguay 12.7¢ Italy 4.8¢ Venezuela 3.7¢ Jamaica 2.9¢ Vietnam 9.3¢ Japan 6.5¢ B. International Switching Facility Tariffed Component Prices There is little information in the public domain concerning the international switching facility component. Carriers in Sweden and the United Kingdom have termination tariffs which could serve as a reference point for international switching costs incurred by a correspondent but these
• http://www.fcc.gov/Bureaus/International/Orders/1999/fcc99313.doc
  • to the measures set forth in section 4.3.1 below. If, after meeting with higher authorized officials, either party determines that further negotiation would be fruitless, then either party may resort to the remedies set forth in Section 4.3.1 below. If resolution of a disagreement requires access to Classified Information, the designees of all Parties shall possess the appropriate security clearances. 4.2 Denial of Access to Information Nothing contained in this Agreement shall limit or affect the authority of the head of a United States Government agency to deny, limit or revoke the Company's access to Classified, Controlled Unclassified, and Sensitive Information under its jurisdiction. 4.3 Enforcement of Agreement 4.3.1. Remedies for Breach. Subject to section 4.1 of this Agreement, if any
• http://www.fcc.gov/Bureaus/International/Orders/1999/fcc99344.doc
  • made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and to protect the DoJ's and the FBI's interests. 4.2 Inspections. Upon reasonable notice and during reasonable hours, the DoJ and the FBI may visit any telecommunications facility of TMI in the United States, and may inspect any part of said TMI facility for the purpose of verifying compliance with the terms of this Agreement and the Implementation Plan. 4.3 Interviews. Upon reasonable notice from the DoJ or the FBI,
• http://www.fcc.gov/Bureaus/International/Public_Notices/1996/da961880.pdf http://www.fcc.gov/Bureaus/International/Public_Notices/1996/da961880.txt
  • November, 1996, in duplicate, in the English and Spanish languages, both texts being equally authentic. FOR THE GOVERNMENT OF THE FOR THE GOVERNMENT OF THE UNITED STATES OF AMERICA: UNITED MEXICAN STATES: APPENDIX 1. The following frequency bands are referred to in Article IV of this Protocol: For DTH-FSS services: Uplink Frequencies Downlink Frequencies 5.925 - 6.425 GHz 3.7 - 4.2 GHz 6.725 - 7.025 GHz 4.5 - 4.8 GHz 1 12.75 - 13.25 GHz 10.70 - 10.95 GHz 11.20 - 11.45 GHz 13.75 - 14.0 GHz 11.45 - 11.70 GHz 10.95 - 11.20 GHz 14.0 - 14.50 GHz 11.70 - 12.20 GHz For BSS services: Uplink Frequencies Downlink Frequencies 17.30 - 17.80 GHz 12.20 - 12.70 GHz 2. This Protocol
• http://www.fcc.gov/Bureaus/Mass_Media/Notices/2000/da001221.doc
  • willingness to reimbursement JKC Communciations of the Virgin Islands for reasonable costs incurred for the channel change. Failure to do so, may result in the dismissal of this proposal. Technical Summary 4. An engineering analysis has determined that Channel 257A can be allotted to Charlotte Amalie in compliance with the Commission's minimum distance separation requirements with a site restriction of 4.2 kilometers (2.6 miles) west; and Channel 258A can be allotted to Frederiksted in compliance with the Commission's minimum distance separation requirements at city reference coordinates. To accommodate the allotments, Channel 293B can be substituted at Christiansted in compliance with the Commission's minimum distance separation requirements with a site restriction of 3.1 kilometers (1.9 miles) southeast at Station WVIQ-FM's presently licensed
• http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.pdf http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.txt http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.wp
  • 1271 13794 830 0.0 0.0 100.0 FL FORT LAUDERDALE 51 52 151.7 262.0 13422 3627 13422 3627 0.0 0.0 100.0 FL FORT MYERS 11 53 1000.0 451.0 36265 1082 34767 1033 7.0 5.4 99.6 FL FORT MYERS 20 15 215.4 451.0 24348 847 24348 847 0.1 0.0 100.0 FL FORT MYERS 30 31 50.0 293.0 16321 651 16188 651 6.5 4.2 100.0 FL FORT PIERCE 21 38 117.7 147.0 11558 446 11088 436 0.0 0.0 100.0 FL FORT PIERCE 34 50 301.7 454.0 24332 1376 23318 1068 0.0 0.0 100.0 FL FORT WALTON BEA 35 25 50.0 60.0 4682 155 4678 155 2.1 0.6 100.0 FL FORT WALTON BEA 53 40 56.2 219.0 12566 488 12574 488 0.0 0.0 99.9 FL
• http://www.fcc.gov/Bureaus/Mass_Media/Orders/2000/da000143.doc
  • 227C, Killeen, is short-spaced to three other FM stations because of construction permit applications granted to stations using the contour protection and directional antenna provisions of Section 73.215 of the Commission's Rules. Specifically, Station KLNC(FM) is short-spaced by 11.5 kilometers to Station KSTV(FM), Channel 226C3, Dublin, Texas, by 18.3 kilometers to Station KPLV(FM), Channel 227C1, Port Lavaca, Texas, and by 4.2 kilometers to Station KKZN(FM), Channel 227C2, Haltom City, Texas, and these three stations are providing contour protection under Section 73.215 to Station KLNC(FM) as if they were fully-spaced stations. 3. The proposed reallotment of Channel 227C from Killeen to Cedar Park, Texas, was filed pursuant to the provisions of Section 1.420(i) of the Commission's Rules, which permit the modification of
• http://www.fcc.gov/Bureaus/Mass_Media/Orders/2000/da000585.doc
  • 92-29-29 WL. FCC Contact: Nancy Joyner (202) 418-2180. (2) MM Docket No. 99-281; RM-9684 Action: At the request of Black Lake Broadcasting, we are allotting Channel 253C3 to Ringgold, Louisiana, an incorporated community, as its first local aural transmission service. Coordinates: 32-19-49 NL; 93-12-33 WL Additional Information: Channel 253C3 can be allotted to Ringgold with a site restriction 6.8 kilometers (4.2 miles) east of the community to avoid short spacings to Station KTAL-FM, Channel 251C, Texarkana, Texas, at coordinates 32-54-11 NL; 94-00-22 WL, and to Station KTUX(FM), Channel 255C1, Carthage, Texas, at coordinates 32-23-19 NL; 94-01-10 WL. FCC Contact: Nancy Joyner, (202) 418-2180. (3) MM Docket No. 99-283; RM-9711 Action: At the request of Gatoradio Media Group, Inc., we are allotting
• http://www.fcc.gov/Bureaus/Mass_Media/Orders/2000/da001108.doc
  • Munford, Tennessee, consistent with the minimum distance separation requirements of Section 73.207(b) and the principal community coverage requirements of Section 73.315(a) of the Commission's Rules at petitioner's requested site 41.2 kilometers (25.6 miles) northeast of the community. Additionally, consistent with the minimum distance separation requirements of Section 73.207(b), Channel 254A can be allotted to Friars Point, Mississippi, at a site 4.2 kilometers (2.6 miles) north of the community. Accordingly, pursuant to the authority contained in Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b) of the Communications Act of 1934, as amended, and Sections 0.61, 0.204(b) and 0.283 of the Commission's Rules, IT IS ORDERED, That effective July 3, 2000, the FM Table of Allotments, Section 73.202(b) of the Commission's Rules, IS
• http://www.fcc.gov/Bureaus/Mass_Media/Public_Notices/Call_Sign_Changes/da992372.doc http://www.fcc.gov/Bureaus/Mass_Media/Public_Notices/Call_Sign_Changes/da992372.txt
  • a minimum, a browser such as Netscape version 3.04 or Internet Explorer version 3.51. To automatically generate a paper version of the FCC Form 159, the above browsers will suffice. However, users electing to pay a required fee electronically by credit card will need a browser version that has a 128-bit encryption capability. Netscape version 4.05 and Internet Explorer version 4.2 have the 128-bit encryption capability required for the elctronic credit card payment option. For further information, please contact Grace Fowler (technical) at (202) 418-2656 or James Brown (legal) at (202) 418-1600. By: Chief, Mass Media Bureau -FCC- Ô Ú à á â ã í î ï ð ó ô õ ö 6 7 8 µ ¶ Ó Ô Û Ü
• http://www.fcc.gov/Bureaus/Miscellaneous/Public_Notices/1999/pnmc9083.doc
  • and employs the latest encryption technology and architecture to safeguard data. Due to security/export limitations of 128-bit SSL encryption, this capability is limited at this time to users in the United States and Canada. The minimum versions of the browsers that have this capability are: For Netscape browsers: Netscape version 4.05 (strong encryption version) For Internet Explorer: Internet Explorer version 4.2 (strong encryption version) You may of course use the current versions of both browsers offered (Netscape 4.7- strong encryption version, and Internet Explorer 5.02-strong encryption version). Currently only Visa or MasterCard credit card payments are supported by the new payment mechanism. However, we plan to support other forms of payment, including ACH, in the future. As a result of this
• http://www.fcc.gov/Bureaus/OPP/working_papers/oppwp35.pdf
  • Staff, or any Commissioner. Given the preliminary character of some titles, it is advisable to check with the authors before quoting or referencing these working papers in other publications. i Table of Contents EXECUTIVE SUMMARY.....................................................................................1 1. INTRODUCTION.........................................................................................7 2. METHODOLOGY - EXPERIMENTAL ECONOMICS..................................9 3. EXPERIMENTAL DESIGN.......................................................................14 3.1 Treatment Variables.......................................................................................................................14 3.2 Experiment Institution...................................................................................................................17 3.3 Performance Measures...................................................................................................................22 4.0 EXPERIMENT RESULTS.........................................................................26 4.1 Economic Efficiency........................................................................................................................27 4.2 Buyer's Bargaining Power.............................................................................................................28 4.3 Buyer Surplus..................................................................................................................................34 4.4 Seller Profits and Losses.................................................................................................................36 4.5 Regression Analysis ­ CAP MFN Treatment Data......................................................................40 5.0 CONCLUDING COMMENTS....................................................................49 APPENDIX A: ECONOMIC THEORY................................................................53 A.1 Traditional Oligopsony/Oligopoly Theory....................................................................................53 A.2 Some Solutions Based on Cooperative Game Theory..................................................................54 A.2.1 The "Nash Bargaining" Solution..............................................................................................56 A.2.2 The "Shapley Value" Solution..................................................................................................56 A.2.3 The "Core" Solution..................................................................................................................57 A.3 Illustration of the Cooperative Solutions for a
• http://www.fcc.gov/Bureaus/OPP/working_papers/oppwp38chart.pdf
  • 2300-2305 5 5 2305-2310 5 5 2310-2320 10 10 2320-2345 25 2345-2360 15 15 2360-2385 25 2385-2390 5 5 2390-2400 10 10 24002402 2 2402-2417 15 2417-2450 33 2450-2483.533.5 2483.5-250016.5 2500-2655155 155 2655-2690 35 35 2690-2700 10 2700-2900200 2900-3100200 COLUMN TOTALS2778 222 200 70 485 123.47 6 116 70 78 % OF TOTAL 100.0 8.0 7.2 2.5 17.5 4.4 0.2 4.2 2.5 2.8 CORE BROADCASTING 960-1215 SHARED LICENSING (PLMRS) GPS CONSIDERED FOR MSS - FLEX SOON TO BE AUCTIONED UNITED STATES SPECTRUM ALLOCATIONS 300 - 3000 MHz GENERAL SERVICE DESCRIPTION (SEE INDICATED PAGE FOR AN EXPANDED VIEW WITH SERVICE NAMES AND FOOTNOTES FROM THE FCC's ALLOCATION TABLE) NOTE: Service names used on this page are the author's own derivations and not
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/209958-2.pdf
  • Content-Type: text/plain Content-Transfer-Encoding: 8bit SAMPLE "A" Volume Control Range RECEIVE Volume Control Range ROLR Def 48+-5 TlA470 4.2.2 8 4.2.2.3 RI FBl ROLR Max Tone=Mid Amp Off/ON Vol=MAX SPL 1 kHz Def Vol SAMPLE "A" SPL 1 kHz Max Vol 42.26 d0 22.69 d0 95.60 dB SPL 116.20 dB SPL 4o.w dB P&W 20.00 10.00 0.00 -lo.w \! 100 200 500 lk 2k 5k 10k . Figure 3 SAMPLE "A" Volume Control Range Volume Control Evaluation - 6ofl6
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/209968-1.pdf
  • should require a manufacture or provider to modify its equipment or service only when the company substantially changes or upgrades its product. Such an approach would be consistent with the recommendation of the Telecommunications Access Advisory Committee. See Telecommunications Access Advisory Committee, Final Report, Access to Telecommunications Equipment and Customer Premises Equipment by Individuals with Disabilities, January 1997, at § 4.2. SBC Communications Inc.: June 30, 1998 Page 28 K. The FCC Should Encourage the Telecommunications Industry To Develop Other Measures To Increase Accessibility to Individuals with Disabilities [NPRM ¶ 174] In the NPRM, the FCC asks whether there are other measures that it might take to increase accessibility to telecommunications products and services -- for example, by establishing a clearinghouse
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210007-2.pdf
  • 20.7 18.8 Figure2: Summary of Measurements 31 .o 56.6 -44.1 52.0 28.5 87.7 111.5 23.5 23.9 - 2.5 - Note: Since ROLR and TOLR are calculated using losses the more neaative the ROLR or TOLR the louder the telephone. - 26 - SAMPLE "A" Volume Control Range -1;/1 BruelgKjaerETS5302Ver 2 52 __ RECEIVE Volume Control Range ROLR Def 46+-5 TIA470 4.2.2 & 4.2.2.3 Rl FBl HOLH Max Tone=Mid Amp Off/ON Vol=MAX SPL 1 kHz Def Vol SAMPLE "A" :;Pl 1 xHz Max Vol -1 40.00 18 PaN 30 00 0.00 -10.00 L--.- ' I I 42.26 dB 100 200 500 ik 2k 5k 10k 1:-- 2:- Frequency(Hz) Figure3 SAMPLE "A" Volume Control flange - 27 - SAMPLE "6" Volume Control Range
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210097-1.pdf
  • obligations on the design, development, and fabrication of equipment and CPE, technical feasibility must be assessed at the time the design, development and fabrication process for a new product or a substantial upgrade for an existing product begins. Retrofitting separate factor). 62 47 C.F.R. § 68.317. 63 See Section III.B.4., n. 40, supra. 64 36 C.F.R. § 1193.2; TAAC § 4.2. 65 See NPRM ¶ 120. 50 products that have already begun the design process should not be required under any circumstances.66 Any requirement to retrofit would waste limited compliance resources, delay product time to market, and slow the pace of innovation in a rapidly changing marketplace where products quickly become obsolete. Any enforcement strategies utilized by the FCC should be
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/210104-1.pdf
  • periods of time.37 Redesigning products that have already been designed to take into account the latest technological developments should not be required under any circumstances.38 Any 34 See NPRM at ¶ 102 (discussing Access Board's decision not to recognize feasibility as a separate factor). 35 NPRM ¶ 101. 36 See NPRM ¶ 120. 37 36 C.F.R. § 1193.2; TAAC § 4.2. 38 See id. -37- redesign requirement would deplete limited compliance resources, delay product time to market, and slow the pace of innovation in a rapidly changing marketplace where products quickly become obsolete. For the same reason enforcement strategies utilized by the FCC should be proactive rather than punitive, directed towards increasing the availability of accessible equipment and CPE in the
• http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/213263-1.pdf
  • a legal matter, commenters correctly note that retroactivity is "generally disfavored in the law" because it can "deprive citizens of legitimate expectations and upset settled 11/ See comments of GTE at 10; SBC Communications, Inc. ("SBC") at 27, citing Access to Telecommunications Equipment and Customer Premises Equipment by Individuals with Disabilities, Final Report, Telecommunications Access Advisory Committee (Jan. 1997) 3 4.2; CTIA at 10-l 1; see also comments of Personal Communications Industry Association ("PCIA") at 18. &J/ For example, in attempting to implement the Hearing Aid Compatibility Act of 1988, the Commission suspended and replaced substantial portions of its implementing regulations in large part because of public concerns over the costs of retrofitting or replacing telephones to comply with those regulations.See
• http://www.fcc.gov/Bureaus/Wireless/Orders/1999/fcc99136.pdf
  • portion of the higher MOUs seen on digital plans is a result of existing high volume customers shifting over from their older, analog plans. 123 See Third Report, 13 FCC Rcd at 19771. 124 The Yankee Group, WIRELESS/MOBILE COMMUNICATIONS GLOBAL, Year-End 1998 Wireless Industry Update: The Impact of All-Inclusive Rates, Report, Vol. 2, No. 46, Dec. 1998, at 8. 24 4.2 percent, which was an increase from the 3.2 percent experienced in 1997. Some operators even experienced quarters with churn as high as 5.5 percent. While cellular operators have lower churn, usually at or below 2 percent,117 their churn levels have grown from 1.9 percent in 1996 to 2.0 percent in 1998. Historically, Nextel has kept its churn around 1.0 percent.
• http://www.fcc.gov/Bureaus/Wireless/Orders/2000/da000925.doc
  • Guidelines''). The petitions of Mobile Phone and TeleTouch and the comments of Metrocall address only Applicants' request for a waiver of the narrowband PCS ownership restriction. Public Interest Statement at 11, 19. Paging Network To Miss Interest Payments, Dow Jones News Service, Jan. 27, 2000. The Strategis Group, The State of the U.S. Paging Industry: 1999 (1999), at 31, Table 4.2. Letter from Kathryn A. Zachem, Counsel for Arch Communications Group, Inc., to Magalie Roman Salas, Secretary, Federal Communications Commission, dated February 23, 2000, at Merged Entity Aggregate Channel Analysis pp. 1-15 (``February 23 Ex Parte Letter''). These 14 markets are Buffalo and Albany, NY; Birmingham, AL; Akron, Cincinnati, Cleveland, Columbus, Dayton, and Toledo, OH; Providence, RI; West Palm Beach and
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8065.pdf
  • 40-42-55.2 N 077-53-44.0 W 0000000371 SCHUYLKILL MOBILE FONE, INC. INDIANA PA RO KGI263 06/17/1998 00152.60000 40-41-14.2 N 079-05-30.1 W 0000000372 SCHUYLKILL MOBILE FONE, INC. CONNELLSVILLE PA RO KGI264 06/17/1998 00152.72000 39-58-23.2 N 079-38-38.1 W 0000000373 SCHUYLKILL MOBILE FONE, INC. DONORA PA RO KGI265 06/17/1998 00152.54000 40-10-48.2 N 079-52-33.1 W 0000000374 SCHUYLKILL MOBILE FONE, INC. VANPORT PA RO KGI266 06/17/1998 00152.81000 40-41-04.2 N 080-21-34.2 W 0000000375 SCHUYLKILL MOBILE FONE, INC. VINELAND NJ RO KNKC32606/17/1998 00454.52500 39-29-09.4 N 075-02-25.6 W 0000000376 SCHUYLKILL MOBILE FONE, INC. BARNEGAT NJ RO KNKC32706/17/1998 00454.42500 39-45-38.4 N 074-15-36.5 W 0000000376 SCHUYLKILL MOBILE FONE, INC. DOVER TOWNSHIPNJ RO KNKC32706/17/1998 00454.47500 39-59-17.4 N 074-12-35.5 W 0000000376 SCHUYLKILL MOBILE FONE, INC. DOVER TOWNSHIPNJ RO KNKC32706/17/1998 00454.62500 39-59-17.4 N 074-12-35.5 W 0000000377
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8087.pdf
  • 0000001079 BRANDENBURG TELEPHONE COMPANYRADCLIFFE KY RM KWH34106/30/1998 00158.10000 37-50-17.2 N 085-56-30.8 W 0000001080 BRANDENBURG TELEPHONE COMPANYGUSTON KY RM KIY459 06/30/1998 00152.81000 37-52-54.2 N 086-12-41.8 W 0000001082 CFW Telephone, Inc. (fka CLIFTON FORGE-WAYNESBORO TELEPHONE COMPANY) CLIFTON FORGE VA RM KNKK75606/30/1998 00158.10000 37-49-53.4 N 079-49-10.1 W 0000001082 CFW Telephone, Inc. (fka CLIFTON FORGE-WAYNESBORO TELEPHONE COMPANY) COVINGTON VA RM KNKK75606/30/1998 00158.10000 37-46-03.4 N 079-59-04.2 W CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000001082 CFW Telephone, Inc. (fka CLIFTON FORGE-WAYNESBORO TELEPHONE COMPANY) LOWMOOR VA RM KNKK75606/30/1998 00158.10000 37-47-16.4 N 079-53-25.1 W 0000001083 CFW TELEPHONE, INC. (fka Clifton Forge-Waynesboro Telephone Company) LEXINGTON VA RM KNKM89606/30/1998 00158.10000 37-47-15.4 N 079-29-10.1 W 0000001085
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8130.pdf
  • KLF501 06/26/1998 00152.84000 40-18-19.2 N 078-54-02.0 W 0000001864 GTE NORTH INCORPORATED NANTY GLO PA RO KLF501 06/26/1998 00152.84000 40-26-17.2 N 078-54-23.0 W 0000001864 GTE NORTH INCORPORATED ROCKWOOD PA RO KLF501 06/26/1998 00152.84000 39-51-51.2 N 079-07-44.1 W 0000001864 GTE NORTH INCORPORATED SOMERSET PA RO KLF501 06/26/1998 00152.84000 40-00-10.2 N 079-01-42.0 W 0000001864 GTE NORTH INCORPORATED WINDER PA RO KLF501 06/26/1998 00152.84000 40-14-04.2 N 078-49-48.0 W 0000001864 GTE NORTH INCORPORATED WINDER PA RO KLF501 06/26/1998 00152.84000 40-14-04.2 N 078-49-48.0 W 0000001865 GTE NORTH INCORPORATED JOHNSTOWN PA RO KLF530 06/26/1998 00152.69000 40-19-15.2 N 078-55-38.0 W 0000001866 GTE NORTH INCORPORATED HARRISBURG IL RO KLF568 06/26/1998 00152.81000 37-44-22.1 N 088-33-16.1 W 0000001867 GTE NORTH INCORPORATED PRINCETON IL RO KLF636 06/26/1998 00152.66000 41-22-15.1 N 089-27-49.3 W 0000001868
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8152.pdf
  • GTE CALIFORNIA INC 00158.10000 GTE CALIFORNIA INC 00152.57000 GTE CALIFORNIA INC 00152.63000 GTE CALIFORNIA INC 00152.72000 GTE CALIFORNIA INC 00152.60000 GTE CALIFORNIA INC 00158.10000 GTE CALIFORNIA INC 00459.02500 BOWLING 41-22-32.0 N RIDGECREST 35-36-50.8 N TRONA 35-45-56.8 N VICTORVILLE 34-36-36.9 N VICTORVILLE 34-36-36.9 N VICTORVILLE 34-36-36.9 N OXNARD 34-1 l-32.0 N BARSTOW 34-54-04.9 N BARSTOW 35-14-18.9 N OH 083-38-35.0 W CA 117-40-04.2 W CA 117-22-14.2 W CA 117-17-17.1 w CA 117-l 7-l 7.1 w CA 117-17-17.1 w CA 119-10-50.3 w CA 117-02-02.1 W CA 116-44-42.1 W MD RO RO RO RO RO RO RO RO Page 1 I CD - Paging and Radiotelephone File Number Applicant Name Call Sign Receipt Date Frequency (MHz) City Latitude Purpose Area Op. RO KNKJ267 RO KNKJ267
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9029.pdf
  • 39-46-15.2 N 082-44-24.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYCOLUMBUS OH RM KWU263 01/29/1999 00152.84000 39-57-22.2 N 082-50-12.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYCOLUMBUS OH RM KWU263 01/29/1999 00931.58750 39-57-51.2 N 082-59-49.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYCOLUMBUS OH RM KWU263 01/29/1999 00152.84000 39-57-54.2 N 082-59-50.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYCOLUMBUS OH RM KWU263 01/29/1999 00152.84000 40-02-04.2 N 082-55-02.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYCOLUMBUS OH RM KWU263 01/29/1999 00152.84000 40-03-03.2 N 083-03-57.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYGROVE CITY OH RM KWU263 01/29/1999 00152.84000 39-52-14.2 N 083-05-11.6 W 0000003745 THE OHIO BELL TELEPHONE COMPANYLANCASTER OH RM KWU263 01/29/1999 00152.84000 39-39-54.2 N 082-36-44.5 W 0000003745 THE OHIO BELL TELEPHONE COMPANYNEW CALIFORNIA OH RM KWU263 01/29/1999
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9051.pdf
  • W Page 4 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000004292 PAGING SYSTEMS, INC. HAYWARD CA RO KNKG60802/24/1999 00931.76250 37-39-44.7 N 122-01-34.8 W 0000004292 PAGING SYSTEMS, INC. INDIA CA RO KNKG60802/24/1999 00931.76250 33-39-23.0 N 115-59-32.9 W 0000004292 PAGING SYSTEMS, INC. JACUMBA CA RO KNKG60802/24/1999 00931.76250 32-40-04.2 N 116-08-17.0 W 0000004292 PAGING SYSTEMS, INC. KELLOGG CA RO KNKG60802/24/1999 00931.76250 38-40-09.6 N 122-37-53.9 W 0000004292 PAGING SYSTEMS, INC. LOS ANGELES CA RO KNKG60802/24/1999 00931.76250 34-13-33.0 N 118-04-00.2 W 0000004292 PAGING SYSTEMS, INC. LOS GATOS CA RO KNKG60802/24/1999 00931.76250 37-06-48.8 N 121-50-08.8 W 0000004292 PAGING SYSTEMS, INC. LOS GATOS CA RO KNKG60802/24/1999 00485.18750 37-10-01.8 N 121-55-29.8 W 0000004292 PAGING
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9066.pdf
  • 02/22/1999 00035.54000 45-14-56.4 N 123-03-28.3 W 0000005193 SIMS COMPANY, INC. DAYTON OR RM KOR793 02/22/1999 00035.54000 45-14-56.4 N 123-03-28.3 W 0000005193 SIMS COMPANY, INC. DAYTON OR RM KOR793 02/22/1999 00035.54000 45-14-56.4 N 123-03-28.3 W 0000005193 SIMS COMPANY, INC. DAYTON OR RM KOR793 02/22/1999 00931.76250 45-14-56.4 N 123-03-28.3 W 0000005193 SIMS COMPANY, INC. DETROIT OR RM KOR793 02/22/1999 00931.76250 44-43-09.4 N 122-13-04.2 W 0000005193 SIMS COMPANY, INC. EUGENE OR RM KOR793 02/22/1999 00035.54000 44-00-07.4 N 123-06-50.3 W 0000005193 SIMS COMPANY, INC. EUGENE OR RM KOR793 02/22/1999 00035.54000 44-00-07.4 N 123-06-50.3 W 0000005193 SIMS COMPANY, INC. EUGENE OR RM KOR793 02/22/1999 00035.54000 44-00-10.4 N 123-06-52.3 W 0000005193 SIMS COMPANY, INC. GRANTS PASS OR RM KOR793 02/22/1999 00931.76250 42-22-55.4 N 123-16-33.2 W Page 21
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9078.pdf
  • TEXAS INC. CLOVIS NM RM KLB315 03/29/1999 00454.75000 34-22-35.2 N 103-13-46.8 W 0000009213 REDI-CALL COMMUNICATIONS COMPANY MIDDLETOWN DE RM KNKI86903/29/1999 00035.24000 39-27-35.4 N 075-43-44.7 W Page 3 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000009305 RING 10 INC. BARTLETT NE RM KNKO45603/30/1999 00454.40000 41-52-57.0 N 098-33-04.2 W 0000009305 RING 10 INC. BARTLETT NE RM KNKO45603/30/1999 00454.60000 41-52-57.0 N 098-33-04.2 W 0000009316 SPECTRUM COMMUNICATIONS, INC ANACONDA MT RM KKB496 03/30/1999 00152.24000 46-06-02.7 N 112-57-02.1 W 0000009316 SPECTRUM COMMUNICATIONS, INC BUTTE MT RM KKB496 03/30/1999 00152.24000 45-46-18.7 N 112-29-45.0 W 0000009316 SPECTRUM COMMUNICATIONS, INC BUTTE MT RM KKB496 03/30/1999 00152.24000 45-59-57.7 N 112-30-58.0 W 0000009316 SPECTRUM COMMUNICATIONS, INC
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9081.pdf
  • PAGE PLUS INCORPORATED EATON OH RM KNKL98303/17/1999 00454.45000 39-45-29.1 N 084-38-24.8 W 0000008018 PAGE PLUS INCORPORATED GREENHILLS OH RM KNKL98303/17/1999 00072.38000 39-16-24.2 N 084-31-36.8 W 0000008018 PAGE PLUS INCORPORATED GREENHILLS OH RM KNKL98303/17/1999 00454.45000 39-16-24.2 N 084-31-36.8 W 0000008018 PAGE PLUS INCORPORATED GREENHILLS OH RM KNKL98303/17/1999 00459.45000 39-16-24.2 N 084-31-36.8 W 0000008018 PAGE PLUS INCORPORATED MIDDLETOWN OH RM KNKL98303/17/1999 00454.45000 39-35-04.2 N 084-21-44.7 W 0000008018 PAGE PLUS INCORPORATED MT. REPOSE OH RM KNKL98303/17/1999 00454.45000 39-11-56.2 N 084-13-11.7 W 0000008018 PAGE PLUS INCORPORATED OXFORD OH RM KNKL98303/17/1999 00454.45000 39-30-46.1 N 084-45-38.8 W 0000008018 PAGE PLUS INCORPORATED SPRINGFIELD OH RM KNKL98303/17/1999 00454.45000 39-56-09.2 N 083-48-43.7 W 0000008018 PAGE PLUS INCORPORATED TAYLOR MILL KY RM KNKL98303/17/1999 00454.45000 39-01-49.2 N 084-30-21.7 W 0000008018 PAGE PLUS
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9101.pdf
  • WA RM KNKB81303/31/1999 00152.54000 47-41-40.6 N 117-20-04.7 W 0000011322 OSTEGO MOBILFONE CORPORATIONONEONTA NY RM KWT87903/31/1999 00152.09000 42-25-10.2 N 075-00-43.5 W 0000011322 OSTEGO MOBILFONE CORPORATIONONEONTA NY RM KWT87903/31/1999 00152.12000 42-25-10.2 N 075-00-43.5 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP CLEARWATER FL RO KDS330 03/31/1999 00454.22500 27-57-45.0 N 082-48-11.3 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP HAINES FL RO KDS330 03/31/1999 00075.58000 28-07-01.0 N 081-37-04.2 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP PALM HARBOR FL RO KDS330 03/31/1999 00075.72000 28-04-46.0 N 082-44-18.3 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP PALM HARBOR FL RO KDS330 03/31/1999 00454.22500 28-04-46.0 N 082-44-18.3 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP SARASOTA FL RO KDS330 03/31/1999 00454.22500 27-19-35.1 N 082-33-41.3 W 0000011083 PORTA-PHONE PAGING LICENSEE CORP ST. PETERSBURG FL RO KDS330 03/31/1999 00454.07500
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9158.pdf
  • W 0000016030 SKYTEL CORP. ST PAUL MN RM KNKL33803/29/1999 00928.98750 44-57-58.8 N 093-10-54.7 W 0000016031 SKYTEL CORP. ASHEVILLE NC RM KNKL34503/29/1999 00931.43750 35-36-04.3 N 082-39-05.4 W 0000016031 SKYTEL CORP. CARY NC RM KNKL34503/29/1999 00931.43750 35-47-03.5 N 078-46-58.0 W 0000016031 SKYTEL CORP. CARY NC RM KNKL34503/29/1999 00931.43750 35-49-54.5 N 078-47-27.0 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00931.43750 35-09-01.5 N 080-46-04.2 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00931.43750 35-13-29.5 N 080-50-49.2 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00931.43750 35-16-03.5 N 080-44-34.2 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00959.88750 35-16-03.5 N 080-44-34.2 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00959.88750 35-16-03.5 N 080-44-34.2 W 0000016031 SKYTEL CORP. CHARLOTTE NC RM KNKL34503/29/1999 00959.96250 35-16-03.5 N 080-44-34.2
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9161.pdf
  • W Page 3 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000016260 SKYTEL CORP. SIOUX FALLS SD RM KNKP26203/29/1999 00931.43750 43-31-56.9 N 096-40-12.1 W 0000016261 SKYTEL CORP. CHARLESTON SC RM KNKP26503/29/1999 00931.43750 32-38-52.6 N 080-07-42.3 W 0000016261 SKYTEL CORP. CHARLOTTE NC RM KNKP26503/29/1999 00931.43750 35-09-01.5 N 080-46-04.2 W 0000016261 SKYTEL CORP. CONWAY SC RM KNKP26503/29/1999 00931.43750 33-47-06.6 N 078-52-43.0 W 0000016261 SKYTEL CORP. GREENVILLE SC RM KNKP26503/29/1999 00931.43750 34-52-17.4 N 082-15-41.4 W 0000016261 SKYTEL CORP. GREENVILLE SC RM KNKP26503/29/1999 00072.24000 34-56-29.4 N 082-24-40.4 W 0000016261 SKYTEL CORP. HILTON HEAD SC RM KNKP26503/29/1999 00931.43750 32-09-38.7 N 080-45-47.3 W 0000016261 SKYTEL CORP. HILTON HEAD SC RM KNKP26503/29/1999 00931.43750 32-09-38.7
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9221.pdf
  • MRCC INC. D/B/A UNICEL BELFAST ME RO KNKN80809/02/1999 44-25-55.3 N 068-53-03.1 W 0000022262 MRCC INC. D/B/A UNICEL BOOTHBAY HARBORME RO KNKN80809/02/1999 43-53-55.3 N 069-36-34.2 W 0000022262 MRCC INC. D/B/A UNICEL Camden ME RO KNKN80809/02/1999 44-12-41.3 N 069-05-23.1 W 0000022262 MRCC INC. D/B/A UNICEL CLINTON ME RO KNKN80809/02/1999 44-37-46.2 N 069-29-11.2 W 0000022262 MRCC INC. D/B/A UNICEL EAST VASSELBOROME RO KNKN80809/02/1999 44-29-04.2 N 069-39-20.2 W 0000022262 MRCC INC. D/B/A UNICEL GARDINER ME RO KNKN80809/02/1999 44-11-32.3 N 069-48-07.2 W 0000022262 MRCC INC. D/B/A UNICEL LiberTY ME RO KNKN80809/02/1999 44-23-28.3 N 069-21-58.2 W 0000022262 MRCC INC. D/B/A UNICEL NEWCASTLE ME RO KNKN80809/02/1999 44-01-31.3 N 069-34-15.2 W 0000022262 MRCC INC. D/B/A UNICEL NORTHPORT ME RO KNKN80809/02/1999 44-18-39.3 N 068-58-23.1 W 0000022262 MRCC INC. D/B/A UNICEL
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9244.pdf
  • 40-19-43.2 N 078-53-38.0 W 0000011032 TELESPECTRUM, INC. MILLHEIM PA RM KNKL56203/31/1999 00454.52500 40-53-29.2 N 077-31-56.9 W 0000011032 TELESPECTRUM, INC. NEW KENSINGTONPA RM KNKL56203/31/1999 00454.52500 40-29-50.2 N 080-16-59.2 W 0000011032 TELESPECTRUM, INC. NEW KENSINGTONPA RM KNKL56203/31/1999 00454.52500 40-31-50.2 N 079-45-18.1 W 0000011032 TELESPECTRUM, INC. NOXEN PA RM KNKL56203/31/1999 00454.52500 41-27-06.2 N 076-00-31.7 W 0000011032 TELESPECTRUM, INC. OAKDALE PA RM KNKL56203/31/1999 00454.52500 40-23-04.2 N 080-10-48.2 W 0000011032 TELESPECTRUM, INC. PHILIPSBURG PA RM KNKL56203/31/1999 00454.52500 40-54-04.2 N 078-12-09.0 W 0000011032 TELESPECTRUM, INC. PITTSBURGH PA RM KNKL56203/31/1999 00072.20000 40-24-54.2 N 080-02-19.1 W 0000011032 TELESPECTRUM, INC. PITTSBURGH PA RM KNKL56203/31/1999 00454.52500 40-24-54.2 N 080-02-19.1 W 0000011032 TELESPECTRUM, INC. PORT MATILDA PA RM KNKL56203/31/1999 00454.52500 40-46-56.2 N 078-02-57.0 W 0000011032 TELESPECTRUM, INC. ROSTRAVER PA RM KNKL56203/31/1999 00454.52500
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9250.pdf
  • IL RM KNKH915 090-10-32.4 W 0000010561 AMERITECH MOBILE SERVICES, INC.JACKSONVILLE 03/29/1999 00931.33750 39-44-08.1 N IL RM KNKH915 088-02-08.2 W 0000010561 AMERITECH MOBILE SERVICES, INC.JOLIET 03/29/1999 00931.33750 41-32-26.1 N IL RM KNKH915 087-51-37.2 W 0000010561 AMERITECH MOBILE SERVICES, INC.LAGRANGE 03/29/1999 00931.33750 41-49-10.1 N IL RM KNKH915 088-05-32.2 W 0000010561 AMERITECH MOBILE SERVICES, INC.LAKE ZURICH 03/29/1999 00931.33750 42-11-17.0 N IL RM KNKH915 087-59-04.2 W 0000010561 AMERITECH MOBILE SERVICES, INC.LEMONT 03/29/1999 00931.33750 41-40-16.1 N Page 16 CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL RM KNKH915 089-19-11.3 W 0000010561 AMERITECH MOBILE SERVICES, INC.LINCOLN 03/29/1999 00931.71250 40-06-25.1 N IL RM KNKH915 088-05-31.2 W 0000010561 AMERITECH MOBILE SERVICES, INC.LISLE 03/29/1999 00931.33750
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9261.pdf
  • Filing Below is a listing of applications, subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AS -Aural Studio Transmitter Link File Number Applicant Name City Call Sign Receipt Date Frequency (MHz) Latitude 0000031652 ALTUS EDUCATIONAL BROADCASTIN ALTUS 09/20/1999 00944.00000 34-40-09.2 N State Longitude OK 099-05-04.2 w Purpose Area Op. NE CD - Paging and Radiotelephone Call Sign File Number Applicant Name City State Purpose Receipt Date Frequency (MHz) Latitude Longitude Area Op. KNKP802 KWU352 KNLS258 KNKL728 KPE440 0000002769 lnabnet Sr., Billy L JACKSON 10/01/1999 00931.66250 32-17-08.5 N 0000002772 AAT PAGING CORPORATION II LATHAM 07/20/l 998 00459.07500 42-45-24.0 N 0000030422 FONES WEST DIGITAL SYSTEMS, INC.DILLON 1
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9309.pdf
  • STONE CITY 11/23/1999 02134.80000 45-18-12.8 N MN RO WNTM755 096-10-40.1 W 0000050865 MINNESOTA, STATE OF MADISON 11/23/1999 02184.80000 45-00-32.8 N MN RO WNTM755 096-10-40.1 W 0000050865 MINNESOTA, STATE OF MADISON 11/23/1999 02188.00000 45-00-32.8 N PA RO WNEZ723 076-32-58.8 W 0000050908 ROBERT PACKER HOSPITAL SAYRE 10/27/1999 23125.00000 41-56-26.2 N PA RO WNEZ722 076-31-56.7 W 0000050930 ROBERT PACKER HOSPITAL SAYRE 10/27/1999 21925.00000 41-57-04.2 N MN RO WNTM759 095-07-19.9 W 0000050934 MINNESOTA, STATE OF WINDOM 11/23/1999 02133.20000 43-50-52.8 N MN RO WNTM759 095-07-19.9 W 0000050934 MINNESOTA, STATE OF WINDOM 11/23/1999 02139.60000 43-50-52.8 N MN RO WNTU867 095-06-09.9 W 0000050935 MINNESOTA, STATE OF WINDOM 11/23/1999 02189.60000 43-51-24.8 N Land Mobile Control Station Meeting the 20 Rule Box/Rectangular KMRA around a centerpoint (not on application) KMRA
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9311.pdf
  • N GA NE 084-29-01.2 W 0000053194 BACKLINK LLC ATLANTA 12/01/1999 22425.00000 33-51-40.5 N GA NE 084-28-33.3 W 0000053195 BACKLINK LLC ATLANTA 12/01/1999 22725.00000 33-52-03.2 N MA NE 071-12-01.2 W 0000053225 BACKLINK LLC BURLINGTON 12/01/1999 22475.00000 42-29-05.1 N MA NE 071-02-04.7 W 0000053393 BACKLINK LLC NORTH QUINCY 12/02/1999 21225.00000 42-16-52.1 N MA NE 071-00-54.0 W 0000053394 BACKLINK LLC QUINCY 12/02/1999 21575.00000 42-14-04.2 N MA NE 071-01-39.9 W 0000053395 BACKLINK LLC QUINCY 12/02/1999 21375.00000 42-13-43.0 N MA NE 071-02-54.0 W 0000053396 BACKLINK LLC QUINCY 12/02/1999 22425.00000 42-14-49.0 N MA NE 071-02-54.0 W 0000053396 BACKLINK LLC QUINCY 12/02/1999 22425.00000 42-14-49.0 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9328.pdf
  • SAN PEDRO 12/22/1999 10955.00000 33-43-22.0 N CA MD WMQ476 120-26-05.6 W 0000061561 GTE MOBILNET OF SANTA BARBARA LIMITED PARTNERSHIP SANTA MARIA 12/22/1999 10628.12500 34-57-14.9 N OK MD WLW404 097-21-27.7 W 0000061584 OKLAHOMA RSA 3 LIMITED PARTNERSHIP GUTHRIE 10/13/1999 06197.24000 35-58-02.9 N OK MD WLW404 097-21-27.7 W 0000061584 OKLAHOMA RSA 3 LIMITED PARTNERSHIP GUTHRIE 10/13/1999 06286.19000 35-58-02.9 N MO MD WLU513 094-25-04.2 W 0000061586 KANSAS CITY SMSA LIMITED PARTNERSHIP PECULIAR 10/25/1999 02121.60000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0000061586 KANSAS CITY SMSA LIMITED PARTNERSHIP PECULIAR 10/25/1999 05974.85000 38-43-20.4 N MO MD WLU513 094-25-04.2 W 0000061586 KANSAS CITY SMSA LIMITED PARTNERSHIP PECULIAR 10/25/1999 06845.00000 38-43-20.4 N MA MD WMW226 071-17-32.0 W 0000061592 SOUTHWESTERN BELL MOBILE SYSTEMS INC WRENTHAM 10/27/1999 06375.14000 42-03-33.0 N
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0015.pdf
  • LOS ANGELES 01/14/2000 19035.00000 34-03-11.0 N FL NE 082-26-48.0 W 0000067931 City of Tampa, Electronics TAMPA 01/10/2000 23475.00000 27-58-43.0 N FL NE 082-27-38.8 W 0000067954 City of Tampa, Electronics Tampa 01/10/2000 23425.00000 27-57-31.7 N IN NE 086-09-53.0 W 0000068407 Indiana Department of Transportation Indianapolis 01/11/2000 23375.00000 39-46-08.2 N IN NE 086-09-13.0 W 0000068408 Indiana Department of Transportation Indianapolis 01/11/2000 23425.00000 39-46-04.2 N TX NE 097-40-22.0 W 0000069193 Round Rock, City of ROUND ROCK 12/30/1999 06648.75000 30-31-04.7 N KY RM WEE402 082-37-11.5 W 0000068515 KENTUCKY, COMMONWEALTH OF ASHLAND 01/11/2000 02194.40000 38-27-43.2 N KY RM WEE402 082-37-11.5 W 0000068515 KENTUCKY, COMMONWEALTH OF ASHLAND 01/11/2000 06815.00000 38-27-43.2 N TX RM WNTX470 098-08-51.0 W 0000069517 Lower Colorado River Authority MARION 01/14/2000 00956.31875 29-37-14.8 N TX
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0052.pdf
  • KATLINK LLC DALLAS 02/24/2000 21575.00000 32-49-20.8 N MO NE 092-31-30.7 W 0000085197 Missouri RSA 11, Inc. California 02/24/2000 06835.00000 38-37-02.1 N MO NE 092-14-58.0 W 0000085200 Missouri RSA 11, Inc. Jefferson City 02/24/2000 06815.00000 38-35-37.0 N IL NE 088-58-15.3 W 0000085203 HLD Cellular Corporation MARION 02/24/2000 06738.12500 37-44-38.2 N IL NE 089-28-25.3 W 0000085211 HLD Cellular Corporation GORHAM 02/24/2000 06527.07500 37-41-04.2 N MA NE 071-02-59.0 W 0000085591 Southwestern Bell Mobile Systems, Inc. BOSTON 02/25/2000 17825.00000 42-18-57.0 N MI NE 083-25-46.0 W 0000085658 BACKLINK LLC Livonia 02/25/2000 22975.00000 42-25-25.3 N MI NE 083-25-13.7 W 0000085659 BACKLINK LLC Livonia 02/25/2000 21225.00000 42-24-53.5 N MI NE 083-25-13.7 W 0000085659 BACKLINK LLC Livonia 02/25/2000 21325.00000 42-24-53.5 N Page 15 CF - Common Carrier Fixed Point
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0060.pdf
  • 0000053776 PHILADELPHIA TELEVISION NETWORK INC Philadelphia 11/08/1999 23475.00000 39-57-06.0 N Page 65 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN NE 086-14-58.0 W 0000055160 Michiana Telecasting Corp SOUTH BEND 11/01/1999 23025.00000 41-42-01.2 N IN NE 086-18-36.0 W 0000055161 Michiana Telecasting Corp SOUTH BEND 11/01/1999 21825.00000 41-42-04.2 N OH NE 081-24-19.2 W 0000058401 AUTOSALES INC TALLMADGE 11/18/1999 23025.00000 41-04-35.0 N OH NE 081-24-19.2 W 0000058401 AUTOSALES INC TALLMADGE 11/18/1999 23125.00000 41-04-35.0 N OH NE 081-25-22.4 W 0000058464 AUTOSALES INC TALLMADGE 11/18/1999 21825.00000 41-04-03.2 N OH NE 081-25-22.4 W 0000058464 AUTOSALES INC TALLMADGE 11/18/1999 23125.00000 41-04-03.2 N NM NE 103-11-40.7 W 0000059005 New Mexico, State of CLAYTON 12/03/1999
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0077.pdf
  • W 0000096022 UNITED TELEPHONE CO OF INDIANA, INC. MONTICELLO 03/09/2000 06063.80000 40-44-48.1 N IN MD WHT426 086-45-50.0 W 0000096022 UNITED TELEPHONE CO OF INDIANA, INC. MONTICELLO 03/09/2000 06093.45000 40-44-48.1 N IN MD WHT426 086-45-50.0 W 0000096022 UNITED TELEPHONE CO OF INDIANA, INC. MONTICELLO 03/09/2000 06152.75000 40-44-48.1 N PA MD WPNE970 078-25-02.0 W 0000096058 PENNSYLVANIA CELLULAR TELEPHONE CORP HOLLIDAYSBURG 03/20/2000 05945.20000 40-27-04.2 N PA MD WPJA752 078-07-58.0 W 0000096093 PENNSYLVANIA CELLULAR TELEPHONE CORP HUNTINGDON 03/20/2000 06197.24000 40-29-52.2 N ME MD WLW700 070-31-37.2 W 0000096199 ATLANTIC CELLULAR TELEPHONE OF DELAWARE LLC CASCO 03/20/2000 06815.00000 43-58-04.2 N Page 6 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0109.pdf
  • CA MD WLM963 121-21-44.7 W 0000112037 SACRAMENTO VALLEY LIMITED PARTNERSHIP TRACY 04/19/2000 10995.00000 37-41-11.7 N CA MD WMN798 121-12-58.7 W 0000112041 SACRAMENTO VALLEY LIMITED PARTNERSHIP GRAYSON 04/19/2000 10563.75000 37-35-23.7 N CA MD WMN797 121-17-18.7 W 0000112047 SACRAMENTO VALLEY LIMITED PARTNERSHIP LATHROP 04/19/2000 10571.25000 37-47-16.7 N TN MD WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 04/20/2000 02165.20000 36-11-04.2 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN MD WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 04/20/2000 02171.60000 36-11-04.2 N TN MD WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 04/20/2000
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0113.pdf
  • N IN NE 086-09-52.9 W 0000117259 PSI ENERGY, INC. WESTFIELD 04/26/2000 06650.00000 40-02-47.1 N AR NE P 094-28-58.0 W 0000117267 CITY OF GENTRY GENTRY 04/24/2000 00956.38125 36-16-00.0 N TX NE 101-57-37.7 W 0000117299 Colorado Interstate Gas Company, Inc. AMARILLO 04/26/2000 00932.36875 35-38-30.2 N TX NE 101-57-37.7 W 0000117299 Colorado Interstate Gas Company, Inc. AMARILLO 04/26/2000 00941.36875 35-38-30.2 N IN NE 086-10-04.2 W 0000117304 PSI ENERGY, INC. Sheridan 04/26/2000 06810.00000 40-05-45.7 N CO NE 104-43-03.9 W 0000117311 Colorado Interstate Gas Company, Inc. Denver 04/26/2000 00928.13125 39-36-10.9 N CO NE 104-43-03.9 W 0000117311 Colorado Interstate Gas Company, Inc. Denver 04/26/2000 00952.13125 39-36-10.9 N WY NE 105-17-30.9 W 0000117320 Colorado Interstate Gas Company, Inc. Douglas 04/26/2000 00928.01875 42-43-09.9 N Page 25 MG - Microwave
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0121.pdf
  • Number Frequency (MHz) Applicant Name Latitude City IA NE 090-31-04.5 W 0000097626 IOWA AMERICAN WATER CO BETTENDORF 03/16/2000 00952.71875 41-33-39.1 N IA NE 090-35-24.5 W 0000097639 IOWA AMERICAN WATER CO DAVENPORT 03/16/2000 00928.74375 41-34-52.1 N IA NE 090-35-24.5 W 0000097639 IOWA AMERICAN WATER CO DAVENPORT 03/16/2000 00952.74375 41-34-52.1 N OH NE 081-41-39.5 W 0000101460 WJW LICENSE INC CLEVELAND 03/07/2000 18590.00000 41-30-04.2 N CA NE 115-30-10.9 W 0000118871 Frontcom.com Inc. Calexico 05/01/2000 22466.50000 32-40-11.2 N IA NE 095-04-31.0 W 0000118925 Northwest Iowa Power Cooperative Manning 05/01/2000 00928.64375 41-54-45.0 N IA NE 095-04-31.0 W 0000118925 Northwest Iowa Power Cooperative Manning 05/01/2000 00952.64375 41-54-45.0 N TX NE 102-10-13.5 W 0000119024 ARCO COMMUNICATIONS INC CRANE 05/01/2000 00932.31875 31-24-26.5 N TX NE 102-10-13.5 W 0000119024 ARCO
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0128.pdf
  • 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18000.00000 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18040.00000 39-46-08.1 N IN NE 086-09-34.4 W 0000126031 KATLINK LLC Indianapolis 05/09/2000 18080.00000 39-46-08.1 N IN NE 086-07-41.8 W 0000126032 KATLINK LLC Indianapolis 05/09/2000 19360.00000 39-45-56.0 N IN NE 086-09-31.2 W 0000126033 KATLINK LLC Indianapolis 05/09/2000 19560.00000 39-46-04.2 N IN NE 086-09-40.5 W 0000126034 KATLINK LLC Indianapolis 05/09/2000 19520.00000 39-45-49.4 N IN NE 086-09-32.5 W 0000126035 KATLINK LLC Indianapolis 05/09/2000 19400.00000 39-45-49.9 N IN NE 086-09-22.7 W 0000126036 KATLINK LLC Indianapolis 05/09/2000 19640.00000 39-45-57.0 N IN NE 086-09-25.3 W 0000126037 KATLINK LLC Indianapolis 05/09/2000 19600.00000 39-46-05.6 N IN NE 086-09-28.3 W 0000126038 KATLINK LLC Indianapolis 05/09/2000 19440.00000 39-46-02.8
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0200.pdf
  • W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19520.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19560.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 19600.00000 37-31-49.5 N CA AM 122-15-52.1 W 0000165251 BACKLINK, LLC REDWOOD SHORES 07/25/2000 22625.00000 37-31-49.5 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17840.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17920.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 17960.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 18040.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC LOS ANGELES 07/28/2000 22675.00000 34-03-04.2 N CA AM 118-15-56.5 W 0000168692 BACKLINK LLC
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0211.pdf
  • CA NE 118-07-55.2 W 0000201564 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 06063.80000 34-08-42.0 N CA NE 118-24-59.2 W 0000201568 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 18120.00000 34-03-37.0 N CA NE 118-27-07.2 W 0000201578 Winstar Wireless Fiber Corp. LOS ANGELES 08/07/2000 19680.00000 34-02-00.0 N CA NE 117-08-11.2 W 0000201579 BACKLINK LLC San Diego 08/07/2000 17800.00000 32-46-08.7 N CA NE 117-08-04.2 W 0000201580 BACKLINK LLC San Diego 08/07/2000 18040.00000 32-46-10.6 N CA NE 117-08-07.0 W 0000201581 BACKLINK LLC San Diego 08/07/2000 17920.00000 32-46-09.2 N CA NE 117-09-39.8 W 0000201582 BACKLINK LLC San Diego 08/07/2000 17840.00000 32-45-44.0 N CA NE 117-09-33.1 W 0000201583 BACKLINK LLC San Diego 08/07/2000 17920.00000 32-46-23.7 N PA NE 075-28-16.6 W 0000201587 BACKLINK LLC BERWYN 08/07/2000 17880.00000 40-03-49.4
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0216.pdf
  • SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10632.50000 42-31-49.0 N MA AM WPNE680 071-08-14.0 W 0000108957 SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10647.50000 42-31-49.0 N MA AM WPNE680 071-08-14.0 W 0000108957 SOUTHWESTERN BELL MOBILE SYSTEMS, INC. SOUTH WILMINGTON 08/14/2000 10667.50000 42-31-49.0 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 02165.20000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 02171.60000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 06226.89000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA NO. 3 LIMITED PARTNERSHIP PARRAGON 08/16/2000 06286.19000 36-11-04.2 N TN AM WLS695 085-24-26.9 W 0000112669 TENNESSEE RSA
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0219.pdf
  • 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22675.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22725.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22825.00000 32-43-27.6 N CA AM WPOM642 117-09-48.6 W 0000167139 BACKLINK LLC SAN DIEGO 08/23/2000 22975.00000 32-43-27.6 N CA AM 117-11-04.2 W 0000167140 BACKLINK LLC SAN DIEGO 08/23/2000 19600.00000 32-44-30.9 N DC AM WPOU557 077-02-03.3 W 0000167148 BACKLINK LLC WASHINGTON 08/24/2000 22475.00000 38-54-02.7 N DC AM WPOU557 077-02-03.3 W 0000167148 BACKLINK LLC WASHINGTON 08/24/2000 22875.00000 38-54-02.7 N CA AM 117-07-53.8 W 0000182460 Teligent License Company II, L.L.C. SAN DIEGO 08/21/2000 17800.00000 32-53-39.4 N Page 8 CF - Common Carrier Fixed Point
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0228.pdf
  • FL MD WPOR205 082-58-49.8 W 0000211768 FLORIDA RSA #8, INC. OLD TOWN 08/29/2000 02124.80000 29-36-41.4 N FL MD WPOR205 082-58-49.8 W 0000211768 FLORIDA RSA #8, INC. OLD TOWN 08/29/2000 02128.00000 29-36-41.4 N PA MD WPJA752 078-07-58.0 W 0000211775 PENNSYLVANIA CELLULAR TELEPHONE CORP HUNTINGDON 08/29/2000 06197.24000 40-29-52.2 N PA MD WPNE970 078-25-02.0 W 0000211780 PENNSYLVANIA CELLULAR TELEPHONE CORP HOLLIDAYSBURG 08/29/2000 05945.20000 40-27-04.2 N IL MD WPQP767 087-52-15.0 W 0000211789 BACKLINK LLC Deerfield 08/29/2000 17800.00000 42-09-08.0 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPQP767 087-52-15.0 W 0000211789 BACKLINK LLC Deerfield 08/29/2000 17840.00000 42-09-08.0 N IL MD WPQP767 087-52-15.0 W
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0239.pdf
  • WMS414 117-12-13.1 W 0000217426 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 19405.00000 32-52-27.2 N CA MD WMS936 117-10-56.1 W 0000217430 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 19525.00000 32-51-08.2 N CA MD WMT761 117-05-50.1 W 0000217432 Verizon Wireless (VAW) LLC SAN DIEGO 09/12/2000 10628.12500 32-43-18.2 N CA MD WLT476 117-01-23.1 W 0000217438 Verizon Wireless (VAW) LLC CHULA VISTA 09/12/2000 10637.50000 32-37-04.2 N CA MD WPOL964 118-15-20.1 W 0000217448 BACKLINK, L.L.C. Los Angeles 09/12/2000 19600.00000 34-02-52.6 N CA MD WPOL964 118-15-20.1 W 0000217448 BACKLINK, L.L.C. Los Angeles 09/12/2000 19680.00000 34-02-52.6 N CA MD WPOL966 118-15-29.3 W 0000217449 BACKLINK, L.L.C. Los Angeles 09/12/2000 18040.00000 34-02-56.7 N CA MD WPOL965 118-15-28.7 W 0000217450 BACKLINK, L.L.C. Los Angeles 09/12/2000 18120.00000 34-03-00.4 N CA MD WLM873
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0252.pdf
  • WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21375.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21475.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21575.00000 42-20-00.6 N MI AM WPOL476 083-03-05.2 W 0000165269 BACKLINK, L.L.C. Detroit 09/25/2000 21675.00000 42-20-00.6 N MI AM 083-02-35.2 W 0000165270 BACKLINK LLC DETROIT 09/25/2000 18080.00000 42-20-04.2 N Page 4 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI AM 083-02-35.2 W 0000165270 BACKLINK LLC DETROIT 09/25/2000 18080.00000 42-20-04.2 N IL AM 087-58-57.4 W 0000168734 BACKLINK LLC ARLINGTON HTS. 09/27/2000 10755.00000 42-08-14.2 N IL AM 087-58-57.4 W 0000168734 BACKLINK
• http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0265.pdf
  • STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 05945.20000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06345.49000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06775.00000 42-04-13.0 N IL MD KSK87 088-18-21.0 W 0000235265 ILLINOIS STATE TOLL HIGHWAY AUTHORITY ELGIN 10/10/2000 06855.00000 42-04-13.0 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 01865.00000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 01875.00000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook 10/10/2000 02142.80000 42-05-39.1 N IL MD WHL68 087-52-04.2 W 0000235267 ILLINOIS STATE TOLL HIGHWAY AUTHORITY North Brook
• http://www.fcc.gov/Bureaus/Wireline_Competition/Orders/2002/fcc02118.pdf
  • 3.4 8.29 4.78 9.07 6.64 7.61 6.22 MR-3-02- 2110 % Missed Repair Appointment ­ Central Office Bus. 12.34 13.13 14.46 11.57 14.51 13.04 9.04 8.08 9.64 8.53 MR-3-02- 2120 % Missed Repair Appointment ­ Central Office Res. 6.49 3.23 8.48 3.33 8.73 11.11 6.59 0 5.73 14.29 MR-3-03- 2100 % CPE/TOK/FOK - Missed Appointment 5.86 6.79 5.68 10.53 5.89 7.31 4.2 4.73 MR-3-04- 2100 % Missed Repair Appointment - No Double Dispatch 5.48 3.11 4.85 3.32 MR-3-05- 2100 % Missed Repair Appointment - Double Dispatch 43.07 30.09 40.88 30.97 MR-4 ­ Trouble Duration Intervals MR-4-01- 2100 Mean Time To Repair ­ Total 20.94 13.91 18.83 13.22 17.12 12.96 18.31 13.1 16.74 12.31 MR-4-02- 2110 Mean Time To Repair ­ Loop Trouble
• http://www.fcc.gov/Daily_Releases/Daily_Digest/2011/dd110617.html
  • or Erica McMahon at (202) 418-0346 [39]DOC-307655A1.doc [40]DOC-307655A1.pdf [41]DOC-307655A1.txt ----------------------------------------------------------------------- --- PUBLIC NOTICES ----------------------------------------------------------------------- --- Released: 06/16/2011. FCC ENFORCEMENT ADVISORY - CRAMMING - ENFORCEMENT BUREAU AGGRESSIVELY PURSUING "CRAMMERS"; CONSUMERS ADVISED TO CAREFULLY REVIEW PHONE BILLS FOR UNAUTHORIZED CHARGES. (DA No. 11-1063) FCC acts on four major investigations against violators of the Commission's cramming rules, with penalties ranging from 1.5M to 4.2M per company, and warns consumers to monitor bills for unauthorized charges. EB . Contact: Mika Savir at (202) 418-0384 or Erica McMahon at (202) 418-0346. News Media Contact: David Fiske at (202) 418-0513 [42]DA-11-1063A1.doc [43]DA-11-1063A1.pdf [44]DA-11-1063A1.txt Released: 06/16/2011. TARIFF TRANSMITTAL PUBLIC REFERENCE LOG. WCB . Contact: (202) 418-0270 [45]DOC-307647A1.pdf [46]DOC-307647A1.txt Released: 06/16/2011. WIRELESS TELECOMMUNICATIONS BUREAU ANNOUNCES CHANGES TO HOW CERTAIN
• http://www.fcc.gov/DiversityFAC/041004/transcript100404.doc http://www.fcc.gov/DiversityFAC/041004/transcript100404.pdf
  • allow for more competition without needlessly increasing interference to existing facilities. And to do this where possible by relaxing engineering and operational regulations that may disproportionately inhibit the development of new and small entrepreneurs which would particularly include minority broadcasters and entrepreneurs. The white paper contains some fairly detailed statistics on the dilemma facing minority broadcasters, most significantly that while 4.2 percent of the broadcast stations, the radio stations, are owned by minorities, they just constitute 1.3 percent of the asset value because minorities tend to have gotten in later. And consequently tend not to own the most powerful and most valuable facilities. In fact, only 3.2 percent of FM stations are minority owned as of 2001 and of those, 40
• http://www.fcc.gov/Speeches/Hundt/spreh714.html http://www.fcc.gov/Speeches/Hundt/spreh714.txt http://www.fcc.gov/Speeches/Hundt/spreh714.wp
  • $23 billion annually in interstate access charges. At present, $7.1 billion is collected by LECs directly from end user customers in subscriber line charges. The remaining $16 billion is collected by LECs from interexchange carriers as follows: Per-Minute Switched Access Charges Carrier Common Line $ 3.7 billion Transport Interconnection Charge $ 2.9 Local Switching (and other traffic sensitive charges) $ 4.2 Total Per-Minute Switched Access Charges $10.8 Transport (Facilities) $ 1.1 Special Access $ 3.1 Information $ 0.3 Miscellaneous $ 1.0 The existing access charge system was adopted at approximately the same time that AT&T divested its local exchange operations and established the seven regional Bell companies pursuant to the Modification of Final Judgment (MFJ). Like the MFJ, the existing access
• http://www.fcc.gov/eb/FieldNotices/2003/DOC-239292A1.html
  • also respond to reports of unlit towers. The FAA also routinely notifies Commission field offices when owners fail to report that lights have been repaired. On July 25, 2002, an agent from the Detroit Office conducted an inspection of the antenna structure located on Webb Ridge Road 0.14 miles east of the intersection of Webb Ridge Road and KY-59, approximately 4.2 miles northwest of Olive Hill, Kentucky. The agent observed no ASR number posted at the site. A search of Commission records and subsequent contacts with FrontierVision revealed that the antenna structure was subject to Part 17 of the Rules, was not registered, and accordingly, needed to be registered. 4. On July 26, 2002, an agent from the Detroit Office conducted
• http://www.fcc.gov/eb/FieldNotices/2003/DOC-268625A1.html
  • must be periodically calibrated so as to provide reliable indications of transmitter operating parameters with a known degree of accuracy." During the inspection, the agent determined that WSNR failed to calibrate its remote monitoring system so that it provided reliable indications of the transmitter's common point current. The station's remote monitoring system indicated a common point current value that was 4.2 percent below the value indicated on the transmitter's common point current meter. Entries in the station log over several months showed similar inaccurate readings. d. 47 C.F.R. S 73.1590(a)(6): "The licensee of each AM, FM, TV and Class A TV station, except licensees of Class D non-commercial educational FM stations authorized to operate with 10 watts or less output power,
• http://www.fcc.gov/eb/FieldNotices/2003/DOC-287609A1.html
  • 2 to 0.46 mW/cm 2 (140 to 230% of the public MPE limits). 7. On June 26, 2008, the Honolulu agent conducted a follow-up inspection at the KTBH-FM transmitter site with a contract engineer for co-located AM radio station KHBC. At the time of the inspection, the transmitter power output (TPO) was 12,200 watts. Using an antenna power gain of 4.2 as specified in the Jampro Antenna Specification Engineering Data, and a line loss of 0.214 dB, the station effective radiated power (ERP) was 48.77 kW, which is 97.5% of the licensee's authorized ERP. Again, the agent employed a personal RF monitor to identify the same two large rectangular areas of concern, along the eastern and western faces of the fence.
• http://www.fcc.gov/eb/Orders/2002/FCC-02-156A1.html
  • The Complaint asserts that AACR's draft agreement contained pricing terms that differed substantially from those proposed by Tricom S.A. Specifically, AACR's draft agreement allegedly set forth a rate of 1.1 cents per minute for local termination of international calls to Tricom S.A. customers, known as the ``international access charge,''31 while Tricom S.A.'s proposed agreement specified an international access charge of 4.2 cents.32 By May 2001, Tricom S.A. and AACR purportedly had failed to reach an interconnection agreement, and Tricom S.A. still had not activated the T-1 lines that AACR purchased in December 2000.33 The Complaint avers that, on May 2, 2001, AACR filed a petition with INDOTEL asking INDOTEL to intervene in AACR's interconnection dispute with Tricom S.A.34 The Complaint advances
• http://www.fcc.gov/eb/Orders/2003/DA-03-2613A1.html
  • 10, 46; Complaint, Exhibit 8 (Bagley Declaration) at 2, 8. 69 Implementation of the Local Competition Provisions in the Telecommunications Act of 1996, CC Docket No. 96-98, Interconnection Between Local Exchange Carriers and Commercial Mobile Radio Service Providers, CC Docket No. 95-185, Order on Reconsideration, 14 FCC Rcd 18049, 18086, 107 (1999) (emphasis added). 70 Complaint, Exhibit 6 (New Contract), 4.2. 71 Complaint at 12, 54-55. See also Reply at 36-37. 72 Response at 18 & Exhibit F (Declaration of Obie Youngblood [``Youngblood Declaration'']) at 2, 9; Exhibit G (Declaration of Ron Marshall [``Marshall Declaration'']) at 2, 5; Exhibit K Davis Declaration at 4-5, 16-18. Neither the Response nor the declarations accuse the Cable Operators specifically of making unauthorized attachments. 73
• http://www.fcc.gov/eb/Orders/2007/DA-07-2279A1.html
  • Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications Commission, dated July 13, 2005 (attaching the affidavit of Caroline Beasley, Vice President and Chief Financial Officer of Beasley Broadcast Group) filed
• http://www.fcc.gov/eb/Orders/2010/DA-10-1258A1.html
  • 9, 2009) ("LOI Response"). 47 C.F.R. S: 4.9(f). See also supra, P: 4. 2004 Network Outage Order, 19 FCC Rcd at 16868 P: 69. See id. at 16834 P: 3, 16868 P:P: 73-75. In the 2004 Network Outage Order, the Commission afforded confidential treatment to network outage reports. 2004 Network Outage Report, 19 FCC Rcd at 16853-55, P:P: 42-46. Section 4.2 of the Rules specifically states that Part 4 outage reports "will be presumed to be confidential" and that public access to outage reports may be sought only pursuant to the procedures set forth in Section 0.461 of the Rules which addresses requests for inspection of materials not routinely available for public inspection. 47 C.F.R. S: 4.2; see also 47 C.F.R.
• http://www.fcc.gov/eb/Orders/da002431cd.doc http://www.fcc.gov/eb/Orders/da002431cd.html http://www.fcc.gov/eb/Orders/da002431cd.txt
  • the Enforcement Bureau of its inquiry into whether QUALCOMM may have violated the Commission's rules, and in accordance with the terms of this Consent Decree, QUALCOMM agrees to the following terms, conditions and procedures regarding compliance with Section 22.921. For the purposes of this Consent Decree, the following definitions shall apply: 4.1 ``Commission'' or ``FCC'' means the Federal Communications Commission; 4.2 ``Bureau'' means the Enforcement Bureau of the Federal Communications Commission; 4.3 ``QUALCOMM'' means QUALCOMM Incorporated; 4.4 ``Parties'' means QUALCOMM and the Bureau; and 4.5 ``Adopting Order'' means an order of the Bureau adopting the terms and conditions of this Consent Decree. The Parties agree that the provisions of this voluntary Consent Decree shall be subject to final approval by the
• http://www.fcc.gov/enbanc/040699/tr040699.pdf http://www.fcc.gov/enbanc/040699/tr040699.txt http://www.fcc.gov/enbanc/040699/tr040699.wp
  • reason 18 gigahertz NPRM is due to the fact 2 that some technology is not sharable technologies. After 3 two years of effort to determine PCS and FS sharing criteria 4 in the 1850 and 1990 megahertz band, over two-thirds of the 5 FS incumbents were relocated by the PCS entrants. 6 The FSS has effectively lost the 3.7 to 4.2 7 gigahertz band, due to its inability to share with licensed 8 GSO downlinks. 9 The FS currently has difficulty coordinating 5.9 10 to 6.4 gigahertz links in many parts of the U.S. due to the 11 large number of satellite uplinks. 12 Just recently, Virginia Power had to get a waiver 13 to go to upper 6 for their
• http://www.fcc.gov/fcc-bin/audio/DA-07-3915A1.doc http://www.fcc.gov/fcc-bin/audio/DA-07-3915A1.pdf
  • Goldendale, Washington, Notice of Proposed Rulemaking, 20 FCC Rcd 1287 (MB 2005). See Monument, Oregon, Order to Show Cause, 21 FCC Rcd 3332 (MB March 31, 2006). Comments of Cumulus Licensing LLC to Order to Show Cause, MB Docket 05-10, May 2, 2006. See Ione, Oregon, Report and Order, 21 FCC Rcd 10017 (MB 2006). See PB APA at § 4.2(a). The Bicoastal APA also provides for the sale of Stations KACI(AM), The Dalles, Oregon, as well as KIHR(AM) and KCGB-FM, Hood River, Oregon, from CGB to Bicoastal. Additionally, the Bicoastal APA provides for the sale of Station KMSW(FM), The Dalles, Oregon, from M.S.W. Communications, LLC to Bicoastal. The proposed assignment of Station KACI-FM to Bicoastal is the only one of
• http://www.fcc.gov/fcc-bin/audio/DA-12-2A1.doc http://www.fcc.gov/fcc-bin/audio/DA-12-2A1.pdf
  • LPFM stations, at 1.3 percent. It is evident that the format specialization of full-service stations is greater because only a small number of such stations carry the format category of ``miscellaneous'' - only 5.1 percent of all full-service stations and 1.4 percent of full-service commercial FM stations fall into this category, compared to 33 percent of LPFM stations. Similarly, only 4.2 percent of full-service stations and 1.0 percent of full-service commercial FM stations have the specific format of ``variety,'' compared to 28.2 percent of LPFM stations. BIA reports that 87 percent of all full-service stations and 89 percent of full-service commercial FM stations have their own websites, percentages that are roughly twice as high as that for LPFM stations. Full-service stations
• http://www.fcc.gov/fcc-bin/audio/DOC-235047A1.doc http://www.fcc.gov/fcc-bin/audio/DOC-235047A1.pdf
  • USA'' Media Market Ownership Shares within Medium Percent Share of Media Market % of Media % of Medium Parent Company # of Stations % Share % Share (AxBxE) Cross Ownership Column F Squared A B C D E F G H TV owner A (Voice 1) 2 25.0 8.5 Voice 1 --- Broadcast TV owner B (Voice 2) 1 12.5 4.2 17.9 Television TV owner C (Voice 3) 1 12.5 4.2 17.9 Stations TV owner D (Voice 4) 1 12.5 4.2 17.9 (8 total) TV owner E (Voice 5) 1 12.5 4.2 17.9 33.8% 100.0% TV owner F (Voice 6) 1 12.5 4.2 17.9 TV owner G (Voice 7) 1 12.5 4.2 17.9 Radio owner A (Voice 1) 3 11.5 2.9
• http://www.fcc.gov/fcc-bin/audio/FCC-03-127A1.doc http://www.fcc.gov/fcc-bin/audio/FCC-03-127A1.pdf
  • MOWG Study No. 7, the NAB/NASA study included data on ABC, NBC and CBS, but did not include data on Fox Television. Disney argues that there is no policy-based rationale for excluding Fox stations. Using the NAB/NASA data, but accounting for all four of the networks, Dr. Baumann determined that network-owned stations on average provide more local news -- about 4.2 hours per week -- than do affiliates in all markets. In markets outside the top 25 markets, network-owned stations provide almost eight more hours of local news each week than affiliates do. Inside the top 25 markets, Disney agrees with the NAB/NASA study results that the difference between network-owned stations and affiliates was not statistically significant. In Dr. Baumann's study,
• http://www.fcc.gov/ib/sand/agree/files/can-bc/can-dtv.pdf
  • km Class VU ­ DTV allotments replacing upper VHF band NTSC, protected coverage 82 km Class C ­ DTV allotments replacing UHF band class C NTSC, protected coverage 70 km Class B ­ DTV allotments replacing UHF band class B NTSC, protected coverage 45 km Class A ­ DTV allotments replacing UHF band class A NTSC, protected coverage 25 km 4.2 Separation Distance Tables The following separation distances were used to determine the technical acceptability of DTV channel allotments. TABLE 4.2.1 UHF BAND ­ DTV -> DTV (90,90/10,10) Separation distances in km Int. A B C VU VL A B C VU VL A B C VU VL Prot. A A A A A B B B B B C C
• http://www.fcc.gov/ib/sand/agree/files/can-nb/24-38fin.pdf
  • to develop sharing agreements that will facilitate reasonable and timely development of broadband wireless systems.3 These agreements should allow for the provision of service by each licensee within its licensed service area to the maximum extent possible. If there is a sharing agreement between the licensees, that agreement shall be followed rather than the coordination process set forth in Section 4.2. 4.2 Coordination in the Absence of a Sharing Agreement - If there is no sharing agreement between the licensees, then proposed facilities shall be coordinated on an individual basis according to the process described below.4 4.2.1The following power flux density (pfd) levels shall apply: 4.2.1.a Power flux density A (`pfd A') has a value of -114 dBW/m2 in any 1
• http://www.fcc.gov/ib/sand/agree/files/can-nb/806-890.pdf
  • the procedues specified in Arrange- ment A annexed to the Agreement concerning the Coordination and Use of Radio Frequencies Above Thirty Megacycles per Second as amended 24 June 1965. Coordination is required for assignments in the 808.2500 to 81 1.2500 MHz, 815.7500 to 818.7500 MHz, 853.2500 to 856.2500 MHz and 860.7500 to 863.7500 MHz bands in the following overlap areas: 4.2 4.2.1 a) The geographical area in Canada enclosed by the meridian of 81OW longitude, the arc of a circle of 100 km radius centered at the intersection of 81OW longitude and the southem shore of Lake Erie and drawn &&vise from the northerly inter- TIAS 12529 8 section with 81OW longitude to intersect the United States-Canada border, and the United
• http://www.fcc.gov/ib/sand/agree/files/can-nb/lmdsagre.pdf
  • or existing systems. 4. Coordination in the 27 GHz Band 4.1 27.5 ­ 28.35 GHz Band - Coordination of LMDS and LMCS systems in the 27.5-28.35 GHz band shall be carried out by the licensees for the respective service areas on both sides of the border, as indicated in Appendix A. This coordination shall be in accordance with Sections 4.3-4.5. 4.2 27.35 ­ 27.5 GHz Band - For the purposes of coordinating Canadian LMCS systems and U.S. fixed and mobile systems in the band 27.35-27.5 GHz, the NTIA represents the U.S. fixed and mobile use of this band.4 Coordination of U.S. fixed and mobile stations with Canadian LMCS systems shall be carried out by NTIA, and the appropriate LMCS licensee(s), as
• http://www.fcc.gov/ib/sand/agree/files/can-nb/mds2way.pdf
  • For example, for a 1 MHz bandwidth, the pfd value corresponding to -108 dBW would be -115.8 dBW. 4 4. Information exchange 4.1 The Administrations will exchange licensee names and points of contact to allow the licensees to contact the relevant licensee(s) on the other side of the border in order to facilitate licensee-to-licensee coordination in accordance with this Arrangement. 4.2 To facilitate cross-border coordination between licensees, the licensees are encouraged to exchange data as listed in Annex A to this Arrangement. 5 Annex A Parameters for Coordination List of parameters that should be provided: Licensee information (Corporate name/Mailing address/Phone/Fax); Location of transmitter (Community/State/Province); Geographical Coordinates of transmitting antenna; EIRP (dBW); Ground elevation and antenna height above ground (m); Centre frequency
• http://www.fcc.gov/ib/sand/agree/files/can-nb/wcsagree.pdf
  • located within 120 km of existing fixed microwave stations that have been authorized by the other Administration prior to the date of this Arrangement are required to coordinate with licensees of such fixed microwave stations if the WCS station would produce a pfd exceeding - 110 dB(W/m2) in any 1 MHz bandwidth at or beyond the border (see Annex A). 4.2 Such coordination shall be based on: · A technical analysis showing that interference is not caused to existing fixed microwave operations of the other Administration. The analysis shall be based on recognized industry procedures such as TIA/EIA Telecommunications Bulletin (TSB10-F), "Interference Criteria for Microwave Systems"; or · Alternatively, a mutually acceptable arrangement between the applicant/operator of the WCS facility and
• http://www.fcc.gov/ib/sand/agree/files/mex-bc/am.pdf
  • of the same frequencyt0substitutefor the cancelled assignment. . In such case,the Administrationshall retain,with respect to the substituting assignment, the rights and obligations of thecancelled assignment, including . priority. However, suchnewassignmentwillnot be permitted to cause objectionable interference to existing stations in the other country at alevel in excess ofthat caused by the cancelled assignment, and which has ken previously accepted. 4.1 4.2 e ARTICLE 4 Notification procedure The date of a notification will be deterruined by the date on which the required information submitted in conformity with this Article is received by the other Administration. If a conflict ,exists between two or morevalidnotifications, prioritywill be given to the notification which has the earlier date of receipt. The information required for the notifications
• http://www.fcc.gov/ib/sand/agree/files/mex-nb/pcs1850e.pdf
  • Coordination with Fixed Point-to-Point Service Operations 4.1Both Administrations agree that the provision of any new PCS service shall be on the basis that harmful interference is not caused to existing stations in the -4- fixed point-to-point service authorized by the other Administration. Both Administrations agree to exchange information on current stations in the fixed point-to-point service before 18 July 1995. 4.2Both Administrations agree to require coordination of all PCS systems located within 72 km (45 miles) of the common border relative to any stations in the fixed point-to-point service within 120 km (75 miles) of the border. Such coordination shall be based on: a) a technical analysis that harmful interference is not caused to existing stations in the fixed point-to-point service
• http://www.fcc.gov/ib/sand/mniab/traffic/files/ITRND01.pdf
  • 4.0 1964 62.9 13.6 14.6 17.2 58.0 138.1 166.3 4,615 3.6 1965 78.2 15.9 20.2 21.3 50.6 150.1 186.2 5,092 3.7 1966 100.1 17.6 29.0 27.3 49.7 177.2 223.7 5,843 3.8 1967 114.2 15.1 31.3 33.7 49.8 197.7 244.0 6,375 3.8 1968 126.9 15.4 36.6 44.3 50.5 221.8 273.8 7,126 3.8 1969 172.0 16.8 45.4 56.0 53.8 281.8 344.0 8,232 4.2 1970 196.6 15.5 49.9 63.1 53.1 312.8 378.2 8,956 4.2 1971 237.4 12.7 52.0 72.5 49.2 359.1 423.8 9,962 4.3 1972 291.8 14.2 57.7 88.3 44.8 424.9 496.9 11,323 4.4 1973 364.9 15.1 62.8 115.0 47.7 527.6 605.5 13,126 4.6 1974 428.7 12.9 64.1 142.7 52.3 623.7 700.8 14,582 4.8 1975 490.2 13.2 69.2 163.4 42.5 696.1 778.5 16,098 4.8
• http://www.fcc.gov/ib/sand/mniab/traffic/files05/CREPOR05.pdf
  • 0.8 0.020.919.6 58.7 $164,671 0.6 0.023.119.8 56.5 $57,897 98.4 0.0 0.0 0.0 1.6 35,632,116 1.6 0.012.232.8 53.4 Malta $1,010,356 6.0 0.5 9.621.9 62.0 $93,865 0.0 0.0 0.017.4 82.6 $430 0.0 0.0 0.0 0.2 99.8 8,175,730 4.4 0.2 6.232.5 56.6 Netherlands $46,126,097 1.4 0.026.219.7 52.7 $9,378,634 1.5 0.010.842.3 45.4 $10,375,680 97.3 0.0 0.0 0.0 2.7 760,730,297 1.3 0.015.331.6 51.8 Norway $16,101,944 4.2 0.014.917.7 63.2 $1,510,863 16.5 0.037.712.0 33.8 $6,588,608100.0 0.0 0.0 0.0 0.0 179,963,091 4.6 0.023.721.3 50.4 Portugal $18,433,780 5.5 0.011.021.2 62.3 $1,214,563 0.8 0.0 4.028.9 66.3 $485,943 97.7 0.0 0.0 0.0 2.3 229,257,919 8.1 0.0 9.922.2 59.8 Spain $62,612,568 6.0 0.033.814.6 45.6 $3,784,926 24.5 0.013.026.8 35.7 $26,588,892 98.1 0.0 0.0 0.1 1.8 570,933,062 10.6 0.020.518.4 50.5 Sweden $25,481,409 2.4 0.113.430.0 54.2
• http://www.fcc.gov/ib/sand/mniab/traffic/files06/CREPOR06.PDF
  • 0.0 0.0 0.026.9 73.1 $4,891 0.0 0.0 0.0 0.0100.0 47,764,241 0.313.114.615.0 57.0 Mauritania $1,070,566 0.113.813.0 1.7 71.4 $75,780 0.0 0.0 0.0 0.0100.0 $1,423 0.0 0.0 0.0 0.0100.0 5,928,107 0.0 9.613.3 2.4 74.7 Mauritius $2,510,964 0.230.9 0.110.8 57.9 $265,327 0.0 0.0 0.0 0.0100.0 $9,919 0.0 0.0 0.0 0.0100.0 18,771,855 0.219.6 0.213.1 67.0 Morocco $28,659,734 0.014.1 7.111.1 67.8 $783,968 0.0 0.0 0.0 4.2 95.8 $8,025 0.0 0.0 0.0 0.0100.0 175,262,967 0.0 5.0 5.912.6 76.5 Mozambique $1,612,206 0.014.6 0.830.9 53.8 $54,446 0.0 0.0 0.0 0.0100.0 $236 0.0 0.0 0.0 0.0100.0 11,881,739 0.0 7.5 1.244.7 46.7 Namibia $1,015,108 0.312.2 0.1 8.0 79.4 $95,219 0.0 0.0 0.0 0.0100.0 $296 0.0 0.0 0.0 0.0100.0 7,263,238 0.2 5.7 0.0 7.3 86.8 Niger $1,962,299 0.017.3 0.125.8 56.7 $22,477 0.0
• http://www.fcc.gov/ib/sand/mniab/traffic/files07/CREPOR07.PDF
  • 65.4 2.9 11.0 20.7 Grenada $7,050,009 0.0 35.2 0.0 7.1 57.7 $419,554 0.0 92.6 0.0 0.3 7.1 $41,617 0.0 0.0 0.0 0.0100.0 66,150,339 0.0 56.5 0.0 6.6 36.9 Guadeloupe $1,848,341 0.0 36.9 7.4 21.0 34.7 $8,504 0.0 0.0 0.0 0.0100.0 $1,106,273 0.0 0.0 0.0 0.0100.0 12,157,091 0.0 30.8 6.7 18.5 44.0 Haiti $118,481,728 0.1 23.7 16.3 6.6 53.4 $2,132,789 0.0 4.2 0.0 2.4 93.4 $7,376,926 0.0 0.0 0.0 0.0100.0 658,747,059 0.2 20.9 16.1 7.6 55.3 Jamaica $100,120,441 0.0 26.0 0.6 15.5 57.9 $2,935,923 0.0 43.0 0.0 23.4 33.6 $2,461,616 0.0 0.0 0.0 0.0100.0 964,953,836 0.0 27.7 0.4 16.7 55.2 Montserrat $504,227 0.0 13.6 0.0 47.3 39.0 $197 0.0 0.0 0.0 0.0100.0 $13,479 0.0 0.0 0.0 0.0100.0 3,979,281 0.0 9.5 0.0 68.9
• http://www.fcc.gov/ib/sand/mniab/traffic/files08/CREPOR08.PDF
  • 0.0 22.2 77.8 $906,837 0.0 0.0 0.0 0.0100.0 410,491,388 0.0 1.5 7.9 29.5 61.1 Yemen $9,738,248 0.0 0.4 1.3 31.4 66.9 $202,088 0.0 0.0 0.0 7.9 92.1 $7,896 0.0 0.0 0.0 0.0100.0 90,804,637 0.0 4.0 1.1 28.8 66.1 Middle East $265,324,450 0.0 0.4 4.5 21.8 73.2 $10,733,517 0.0 0.0 0.0 16.2 83.8 $9,076,291 0.0 0.0 0.0 0.0100.0 2,755,525,811 0.0 0.4 4.2 26.6 68.8 Anguilla $1,246,217 0.0 0.0 0.0 20.9 79.0 $10,404 0.0 0.0 0.0 0.0100.0 $204,634 0.0 0.0 0.0 0.0100.0 6,948,645 0.0 0.0 0.0 25.3 74.7 Antigua and Barbuda $4,277,235 0.0 0.0 0.1 22.4 77.5 $52,596 0.0 0.0 0.0 0.0100.0 $103,406 0.0 0.0 0.0 0.0100.0 36,439,428 0.0 0.0 0.1 25.5 74.4 Aruba $4,898,908 0.0 0.0 0.4 14.1 85.5 $69,952 0.0 0.0
• http://www.fcc.gov/mb/engineering/usallochrt.pdf
  • RADIONAVIGATIONSATELLITE (S-E) RADIOLOCATION Amateur Radiolocation AERONAUTICALRADIONAVIGATION SPA CE RESEARCH ( Passive) EARTH EXPL SAT (Passive) RADIO ASTRONOMY MOBILE MOBILE ** FIXED-SAT (E-S) FIXED FIXED FIXED** LAND MOBILE (TLM) MOBILE SAT.(Space to Earth) MARITIME MOBILE SAT.(Space to Earth) Mobile(Aero. TLM) MOBILE SATELLITE (S-E) MOBILE SATELLITE(Space to Earth) AERONAUTICAL MOBILE SATELLITE (R) (space to Earth) 3.0 3.1 3.3 3.5 3.6 3.65 3.7 4.2 4.4 4.5 4.8 4.94 4.99 5.0 5.155.25 5.35 5.46 5.47 5.6 5.65 5.83 5.855.925 6.425 6.525 6.706.875 7.0257.075 7.125 7.197.235 7.25 7.30 7.45 7.55 7.75 7.90 8.025 8.175 8.215 8.4 8.45 8.5 9.0 9.2 9.3 9.5 10.0 10.45 10.5 10.5510.6 10.68 10.7 11.7 12.2 12.7 12.75 13.2513.4 13.75 14.0 14.2 14.4 14.4714.514.7145 15.1365 15.35 15.415.43 15.6315.716.6 17.1 17.217.317.717.818.318.618.8 19.319.7 20.120.221.2
• http://www.fcc.gov/mb/peer_review/docs/prtpkieschnick.pdf
  • measured raises questions about just what the data represent and why they are relevant. While one might conjecture that the author was talking about earnings before interest, taxes, depreciation and amortization, I can think of several alternative definitions of cash flow used in the financial community and so the author's definition needs to be clarified before its usefulness can accessed. 4.2 The discussion in the report suggests that the reported data reveal something important about the financial welfare of the reporting television stations. While an accountant might find the data relevant to revealing something about the financial welfare of the reporting television stations, an economist, or financial analyst, or investor would find the data inadequate for this purpose. Let me illustrate
• http://www.fcc.gov/mb/peer_review/prlpfm_rpt_economic_study.pdf
  • format for LPFM stations, at 1.3 percent. Itis evident that the format specialization of full-service stations is greater because only a small number of such stations carry the format category of "miscellaneous" ­only 5.1 percent of all full-service stations and 1.4 percent of full-service commercial FM stations fall into this category, compared to 33 percent of LPFM stations. Similarly, only 4.2 percent of full-servicestations and 1.0 percent of full-service (Continued from previous page) stations have higher antenna heights that allow them greater range than LPFM stations are permitted. These 28 stations had a median HAAT of 1,021 meters and an average HAAT of 1,207 meters. 19A staff CDBS data analysis has determined that the medianpower level and antenna height of full-service
• http://www.fcc.gov/oet/info/documents/reports/SHVERA/SHVERA-FCC-05-199.pdf
  • TOV. It is clear from the plot that most of the variation in receive sensitivity (i.e., minimum signal level at TOV) of the DTV receivers is due to variations in receiver noise figures rather than variations in the CNR required by the demodulator. In fact, based on standard deviations of the parameters, variability in noise figure among the receivers is 4.2 times as high as the variability in required CNR on channel 30, where the noise figure variations are smallest. On channels 10 and 3, respectively, the noise figure shows 7 and 16 times the variability of required CNR. Federal Communications Commission FCC 05-199 5-5 Added White Noise [+ Receiver Noise] Apply Clean Signal + Noise Required CNR PerfectReceptio n NoPicture
• http://www.fcc.gov/oet/info/peerreview/docs/SHVERA-peer-review-memo.doc
  • TOV. It is clear from the plot that most of the variation in receive sensitivity (i.e., minimum signal level at TOV) of the DTV receivers is due to variations in receiver noise figures rather than variations in the CNR required by the demodulator. In fact, based on standard deviations of the parameters, variability in noise figure among the receivers is 4.2 times as high as the variability in required CNR on channel 30, where the noise figure variations are smallest. On channels 10 and 3, respectively, the noise figure shows 7 and 16 times the variability of required CNR. (a) Required CNR (b) Minimum Signal at TOV -1. Relationship between Minimum Signal at TOV and Required CNR -2. Noise Figure on
• http://www.fcc.gov/ogc/documents/opinions/2003/02-1131.pdf
  • Percent Interstate Usage (``PIU'') to [Verizon TTT , which] shall have the same options, and to the extent it avails itself of them, the same obligation, to provide PIU and PLU information to [Starpower]. To the extent feasible, PLU and PIU information shall be based on the actual end-to-end jurisdictional nature of each call sent over the trunkTTTT [Emphasis supplied.] 4.2 Reciprocal Compensation for the exchange of Local Traffic is set forth in Table 1 of this Attachment and shall be assessed on a per minute-of-use basis for the transport and termination of such traffic. ``Reciprocal Compensation'' is defined in Part B as a reciprocal compensation arrangement between two car- riers in which each of the two carriers receives compen- sation
• http://www.fcc.gov/omd/contracts/pre-award/RevisedSOW-110729.pdf
  • the products or services of its actual or prospective competitors. Federal Communications Commission FCC-SOL11000004 Page 4 of 8 4.0 NON-DISCLOSURE 4.1 In the course of performance pursuant to this task order, the contractor will access nonpublic information, including acquisition sensitive information. The contractor agrees that it will not use or disclose any such information unless authorized by the Contracting Officer. 4.2 The contractor further agrees that it will use its best efforts to ensure that its employees and others performing services under this contract will not use or disclose any such information unless authorized by the Contracting Officer. To that end, contractor agrees that its employees and others performing duties under this contract will sign the Certificate of Nondisclosure. 4.3 By
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-broadband-dead-zone-report.pdf
  • and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. The Broadband Dead Zone Report and Consumer Broadband Test are only collecting data for these specific purposes, as noted in the OMB submission under the Paperwork Reduction Act (PRA) regulations and metrics (see Question 4.2). Information is reliable for its intended use(s). The FCC has employed industry standard testing software Information is accurate. The information received is accurate for its intended use, and as noted above, the Broadband Report and Test comply with the PRA metrics. Information is complete. As noted above, the Broadband Report and Test comply with the PRA metrics; also note that
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-ccd.pdf
  • is current. Not applicable: The information that submitters provide is from non-FCC sources, i.e., participants in the PSHSB summits, forums, and conferences, etc., and the public-at-large, who submit comments voluntarily. Please explain any exceptions or clarifications: If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) 20 Yes, information is collected from non-FCC sources: The information that submitters provide is entirely from non-FCC sources, i.e., participants in the PSHSB's public forums, summit
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-core-financial.pdf
  • financial transactions with the FCC) is reliable, accurate, complete, and current. Inaccurate and/or out-of- date information would be detrimental to the design, operations, and purposes for which the FCC is designing the CFSR financial system. 20 If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: [we need to discuss this-you've said in several questions that business, etc. will use CFSR for financial transactions with
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-criminal-investigative-files.pdf
  • for its intended use(s). Information is accurate. Information is complete. Information is current. Not applicable: Please explain any exceptions or clarifications: The Office of Inspector General (OIG) is exempt from the Data Quality guidelines requirements. 22 If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-crisis.pdf
  • adhere to the Data Quality guidelines, e.g., that the data are reliable, accurate, complete, and current. Inaccurate, erroneous, and/or out-of-date information would be detrimental to the purposes for collecting, maintaining, and using the information in emergencies. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-dqc.pdf
  • reliable for its intended use(s). Information is accurate. Information is complete. Information is current. Not applicable: The Data Quality Comments information system does not include any data from FCC sources. Please explain any exceptions or clarifications: If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-ecfs.pdf
  • Electronic Comment Filing System (ECFS) information system, including the personally identifiable information (PII) covered by FCC/CGB-2, "Electronic Comment Filing System (ECFS)" SORN, that individuals submit to the FCC via this information system comes from non-FCC sources. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-email.pdf
  • FCC's Intranet and Internet regulations by signing FCC Forms A-201, "Power User Account Certification Form," FCC Form A-203, "Computer System Separation Clearance Form," and FCC Form A-204, "Modem Use Certification Form," before they are granted access. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: FCC computer users, e.g., FCC employees, interns, co-op students, and contractors, etc., send and receive e-mails from individuals, businesses,
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-experimental-radio.pdf
  • contained in the Experimental Radio Station License Files information system, including the personally identifiable information (PII) covered by FCC/OET-1, "Experimental 22 Radio Station License Files" SORN, that applicants submit to the FCC comes from non-FCC sources. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Applicants and licensees who have applied for or been granted or a renewal of an experimental radio station license.
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-faca.pdf
  • exceptions or clarifications: The information contained in the Federal Advisory Committee Membership File (FACA) information system, including the personally identifiable information (PII) covered by FCC/OMD-3, "Federal Advisory Committee Membership File (FACA) )"SORN, comes from non-FCC sources. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Each individual who is a member of a FACA committee or subcommittee. Information is processed and maintained only for
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-financial.pdf
  • regulatory fees and other financial payments, i.e., businesses, institutions, etc., are reliable, accurate, complete, and current. Inaccurate and/or out-of-date information would be detrimental to the purposes for collecting, maintaining, and using the information in emergencies. 18 If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-foia.pdf
  • exceptions or clarifications: The FCC tries to insure that information in FCC/OMD-17, "Freedom of Information Act (FOIA)," SORN paper files and electronic databases that includes personal identifiable information (PII) on individuals meets the Data Quality guideliness. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-general-investigative-files.pdf
  • for its intended use(s). Information is accurate. Information is complete. Information is current. Not applicable: Please explain any exceptions or clarifications: The Office of Inspector General (OIG) is exempt from the Data Quality guidelines requirements. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 22 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-ils.pdf
  • access with the approval of their COTR) who register to use the FCC Library. These individual must provide the correct information, since knowingly providing false or misleading information may result in the loss of library privileges. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-investigations-hearings.pdf
  • system, including the personally identifiable information (PII) covered by FCC/EB-3, "Investigations and Hearings" 21 SORN, consists of the electronic records and data and paper documents and files in these complainant filings, which are from non-FCC sources. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-labor-employee-relations.pdf
  • based on conduct or performance, grievances, requests for reconsideration, arbitration, appeals, miscellaneous inquiries and complaints, and other personnel actions. The failure to adhere to the Data Quality standards may result in legal actions against the Commission. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-lmts.pdf
  • Congressional correspondence and inquiries. These Congressional correspondence and inquiries may include matters concerning FCC employees, i.e., personnel actions or complaints, etc. The OLA staff adheres to the Data Quality Guidelines in all its responses to Congress. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Congressional correspondence, i.e., constituent inquiries, which may include their constituent's PII either as stated in the correspondence or as
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-pams.pdf
  • is to the benefit of each individual participant that his/her information is accurate and up-to-date in the event that an emergency situation occurs, and the individual must log-in to receive the emergency response action plan guidance. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-pay-leave-garnish.pdf
  • including the personally identifiable information (PII) covered by FCC/OMD-14, "Pay, Leave, and Garnishment Records" SORN, must comply with the Data Quality guidelines. FCC employees must also verify that the information they provide is accurate and up-to-date. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Internal Revenue Service, U.S. Department of Agriculture, U.S. Treasury, National Treasury Employees Union, and State income tax agencies, etc.
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-personal-security-files.pdf
  • and employee assistance program staff (EAP); and (3) Individuals who are neither applicants nor employees of the Federal Government, but who are or were involved in Federal programs under a co-operative agreement, e.g., students and interns. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-physical-access.pdf
  • and 2. Individuals authorized to perform or use services provided in FCC facilities on an infrequent basis, e.g., and service and maintenance workers performing cleaning, maintenance, and repair duties in the Commission's buildings and facilities. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 23 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-reasonable-accommodation-requests.pdf
  • his/her major life activity(s)) warrant this accommodation by the FCC, as required by EEOC regulations. The FCC may investigate any discrepancies in the data that individuals provide to prove that their requests meet the requisite guidelines. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Individuals requesting reasonable accommodations may submit medical records and other data along with EEOC Form 557 and the FCC's
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-remedy.pdf
  • facsimile machines, and scanners, etc., must also complete and sign FCC Form A-535, "Self- Certification Form," verifying that they are in possession of this equipment as part of the FCC's annual physical inventory of FCC property. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-rmis.pdf
  • payments and conduct other financial transactions with the FCC using RMIS, is reliable, accurate, complete, and current. Inaccurate and/or out-of-date information would be detrimental to the design, operations, and purposes for which the FCC uses RMIS. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Applicants who register with the Commission in RMIS to pay regulatory fees, to apply for or renew licenses, and
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-small-business-contacts.pdf
  • for its intended use(s). Information is accurate. Information is complete. Information is current. Not applicable: Please explain any exceptions or clarifications: All the information in the Small Business Contacts List information system comes from non-FCC sources. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Small, minority, and women-owed communications businesses and related groups. Information is processed and maintained only for the purposes for
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-telephone-call-details.pdf
  • co-op students, temporary hires, visitors, and contractors working at the FCC. The Commission believes that the telephone call detail data meet the Data Quality guidelines. The FCC will investigate will investigate any discrepancies in these data. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-transit.pdf
  • to which he/she were not entitled. In such cases, i.e., obtaining the subsidy or handicapped parking permit, may be subject the individuals to criminal prosecution, as under 18 U.S.C. 1001 for violating the transit subsidy provisions. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: FCC employees, paid interns, and co-op students must obtain a commuting trip calculation from WMATA and provide this information
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-uls.pdf
  • intended use(s). Information is accurate. Information is complete. Information is current. Not applicable: The ULS information system does not collection information from FCC employees and contractors working at the FCC. Please explain any exceptions or clarifications: If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Applicants who register with the Commission to obtain licenses and to conduct other business using the FCC's ULS information
• http://www.fcc.gov/omd/privacyact/System_of_records/pia-violators.pdf
  • information contained in the Violators Files information system, including the PII covered by FCC/EB-1, "Violators Files" SORN, includes inspection reports, complaints, monitoring reports, investigative cases, etc., concerning individuals who are the subjects of FCC enforcement actions. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Individuals who are the subjects of FCC field enforcement actions or about whom there are questions of compliance with
• http://www.fcc.gov/omd/privacyact/System_of_records/pshsb-coop-plan.pdf
  • (PCOOD) in PSHSB. PCOOD assumes that each individual will provide correct information since the individual benefits in having his or her personal information as accurate and up-to-date as possible in the event an emergency situation occurs. If the Data Quality Guidelines do not apply to the information in this information system, please skip to Section 5.0 Safety and Security Requirements: 4.2 Is any information collected from non-FCC sources; if so, how will the information sources be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply and provide an explanation) Yes, information is collected from non-FCC sources: Information is processed and maintained only for the purposes for which it is collected: Information is reliable for its
• http://www.fcc.gov/ownership/materials/already-released/localismwelfare060005.pdf
  • {(1 23+23 )+ ³13 43 ´} 0( 1)=0 Inserting =12+ 6 indicatesthisisjustalinearequationinquality di erences,namely µ1 2 6 µ 1 3+ 4 3 ¶¶ = 0( 1) (23) Byasimilartoken,themassproducer'squalityshould(second-best)opti- mallybe: P = {( )(1 23+23 )+(1 )³23 23 ´} 0( 0). Solvingoutinasimilarmannertothataboveyields: P = µ1 2+ 6 µ 1 3+ 4 3 ¶¶ = 0( 0) (24) Wecannowcomparetheoptimalsolutionfrom(23)and(??)totheequi- libriumonefrom(21)and(22).Todoso,itisfirstinstructivetoconsiderthe case =1. 4.2The"pricing"solution When =1,thenuisancecosttoviewersfromadvertisingisexactlyequalto thesocialbenefittoadvertisers(recallthatthesocialbenefithasbeensetto 1).Hence,inthiscase,thesolutionisjustasiftherewasadirectprice,for instanceasubscriptionpricetotheserviceso ered.Toseethis,itsu cestoset =1intheaboveequations,andreadthe variablesasdirectpricesfaceby consumersandsetbyfirms.Theimportantinsightfromthisisthebenchmark thattheoptimumandequilibriumconditionsareexactlythesame.Namely, theequations(21)and(22)and(23)and(??)reducetothesamething.This meansthatoptimumandequilibriumqualityprovisionexactlycoincide. Theintuitionisasfollows.Whenaproducersetsqualityandpricestogether, anyincrementalqualitycanbeimmediatelymonetizedandleavesharesineach 10 marketunchanged.Forexample,raisingqualitybyoneunitandraisingprice byoneunitwillchangenoconsumer'sutilityandthereforenotchangethe producer'smarket.Therefore,qualityprovisionisoptimal.3 Thisisausefulbenchmarkcasebecausewecannowseehowthemarket equilibriumandoptimumsolutionsarea ectedbyraising aboveone.This willcorrespondtoacasewhereadvertisingisanuisancerelativetoitssocial value(atthemargin). 4.3Comparingoptimumandequilibrium Forthegeneralcase,itismoretransparenttoanalyzetheequilibriumand optimumforsymmetriclocalmarkets.Therefore,setthemallequalwithsize 1,andlettherebe ofthem.Thequalitiesinalllocalmarketsarethenthe same.Let denotethequalitydi erence, 0 1. Considerfirsttheequilibrium.Theconditionsforthelocalfirmsare 1 2 6 = 0( 1) (25) whilethemass-producerfirmfaces µ1 2+ 6 ¶ = 0( 0) (26) Thecaseofanexponentialcostfunctionisausefulbenchmark.Thenwehave thattheratioofthetwoequationsabove(whichdeterminestheequilibrium ) isindependentof .Hencetheequilibrium isindependentof .Lookingatthe equationsandtaking
• http://www.fcc.gov/ownership/materials/already-released/review090001.pdf
  • While the number of radio stations has grown, the number of radio owners has declined by 6.7 percent from March 1996 to November 1997 (from 5,133 to 4,788 owners), by an additional 5.8 percent from November 1997 to November 1998 (from 4,788 to 4,512), by another 11.2 percent from November 1998 to March 2000 (from 4,512 to 4,006), and by 4.2 percent from March 2000 to March 2001 (from 4,006 to 3,836). As of March 2001, there were 3,836 owners of commercial radio stations across the nation, for a cumulative decline in the number of owners of 25 percent since March 1996. The decline in the number of owners reflects a general continuation of the consolidation of the commercial radio industry
• http://www.fcc.gov/ownership/materials/already-released/survivor090002.pdf
  • high year 2000 margins of ABC compared to NBC probably do Television Station Advertising Volume Broadcast Advertising Revenue Total Commercial Television Stations TV Station Advertising Revenue per Station in Current Dollars Broadcast Advertising Revenue Per Station in Current Dollars Television Station Advertising Revenue per Station in Constant Dollars Broadcast Advertising Revenue per Station in Constant Dollars 1975 2,957 5,263 706 4.2 7.5 7.8 13.9 1980 6,236 11,416 734 8.5 15.6 10.3 18.9 1985 11,718 20,298 883 13.3 23.0 12.3 21.4 1990 15,644 26,616 1092 14.3 24.4 11.0 18.6 1991 14,675 25,461 1098 13.4 23.2 9.8 17.0 1992 15,630 27,249 1118 14.0 24.4 10.0 17.4 1993 16,235 28,020 1138 14.3 24.6 9.9 17.0 1994 18,457 31,133 1145 16.1 27.2 10.9 18.3 1995
• http://www.fcc.gov/ownership/roundtable_docs/waldfogel-b.pdf
  • 0.0 0.0 Album Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemp. Hit Radio (CHR, top40) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7
• http://www.fcc.gov/ownership/roundtable_docs/waldfogel-c.pdf
  • 0.0 0.0 Album Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemporary Hit Radio (CHR) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5
• http://www.fcc.gov/pshs/docs-psap/etns060404.pdf
  • telephone number daily database's moves, adds, and changes (MACs) has on the locally listed and unlisted telephone number database. The greater the percent of change, the more frequently the ETNS system database should be updated. For instance: Industry research indicates that the E9-1-1 database changes at the rate of approximately 0.4 percent every single day, or the equivalent of approximately 4.2 million households each day getting new telephone service, relocating existing services, changing telephone numbers or disconnecting their telephone service. The frequency of updates of the 9-1-1 database extracts is often set by state tariff and thus, is not a part of the recommendation. However, any agency that purchases an ETNS system should be aware of the need for current and
• http://www.fcc.gov/pshs/docs-psap/nena-aid062505.pdf
  • TERMINOLOGY..............................................................................................................................6 2.6 REASON FOR REISSUE......................................................................................................................................6 2.7 COST FACTORS.................................................................................................................................................6 2.8 COST RECOVERY CONSIDERATIONS.................................................................................................................7 2.9 ACRONYMS/ABBREVIATIONS...........................................................................................................................7 3 MUTUAL AID AGREEMENTS......................................................................................................................8 3.1 PARTIES...........................................................................................................................................................8 3.2 AUTHORITY......................................................................................................................................................8 3.3 DEFINITIONS....................................................................................................................................................8 3.4 ASSISTANCE TO BE RENDERED.........................................................................................................................8 3.5 CONDITION(S) FOR IMPLEMENTATION..............................................................................................................8 3.6 REQUEST FOR IMPLEMENTATION......................................................................................................................8 3.7 IMPLEMENTATION............................................................................................................................................8 3.8 DEMOBILIZATION.............................................................................................................................................9 3.9 COMPENSATION...............................................................................................................................................9 3.10 INSURANCE......................................................................................................................................................9 3.11 LIABILITY.........................................................................................................................................................9 3.12 MAINTENANCE.................................................................................................................................................9 3.13 EXCLUSIVITY...................................................................................................................................................9 3.14 SIGNATURES.....................................................................................................................................................9 4 REFERENCES.................................................................................................................................................10 4.1 AMERICAN RADIO RELAY LEAGUE................................................................................................................10 4.2 COMMONWEALTH OF KENTUCKY STATEWIDE EMERGENCY MANAGEMENT MUTUAL AID AND ASSISTANCE AGREEMENT.................................................................................................................................................................10 4.3 FLORIDA CHAPTER ASSOCIATED PUBLIC SAFETY COMMUNICATIONS OFFICIALS..........................................10 4.4 NORTH CAROLINA CHAPTER OF THE NATIONAL EMERGENCY NUMBER ASSOCIATION..................................10 4.5 NORTH CAROLINA STATEWIDE EMERGENCY MANAGEMENT MUTUAL AID AND ASSISTANCE AGREEMENT..10 4.6 STATE OF WASHINGTON MUTUAL AID AND INTERLOCAL AGREEMENT.........................................................10 5 EXHIBITS........................................................................................................................................................11 5.1 SAMPLE INTERSTATE MUTUAL AID AGREEMENT...........................................................................................11 5.2 SAMPLE INTRASTATE
• http://www.fcc.gov/pshs/docs/clearinghouse/plans/santalouisacaemergplan.pdf
  • RACES only plan- COUNTY Rev 4 7/29/01 PAGE 6 COUNTY OF SANTA LUISA RADIO AMATEUR CIVIL EMERGENCY SERVICE PLAN 4.0 ORGANIZATION (Customize to local emergency management agency titles) 4.1 Operational Area emergency services organization applicable to the RACES is: COUNTY DISASTER COUNCIL COUNTY EXECUTIVE OFFICER DIRECTOR OF EMERGENCY SERVICES EMERGENCY SERVICES COORDINATOR JURISDICTION RACES COORDINATOR (title may vary) RACES OFFICER 4.2 The volunteer (unpaid) staff position responsible for the implementation and administration of this service is the RACES Officer appointed by the County of Santa Luisa. The RACES Officer is directly responsible to the county paid-staff coordinator position and serves at the pleasure of the holder of that position. While an FCC Amateur radio license is beneficial it is not mandatory
• http://www.fcc.gov/pshs/docs/clearinghouse/plans/valleycommctr.pdf
  • recipient may view. VALLEY COMMUNICATIONS CENTER STANDARD OPERATING PROCEDURES POLICY NUMBER: 501 ELECTRONIC MESSAGING Date Originated: 02/04/94 Revised: 02/24/05 4.1.5 Messages directed to the wrong recipient. 4.1.6 Messages saved/stored but not cleared from storage prior to logging off the systems and/or leaving their terminal. This is also applicable to the stored message buffer and scratchpad features of mobile data devices. 4.2 Electronic Messaging Audits: 4.2.1 Each system shall be evaluated for the most appropriate method to audit. For the purpose of operational systems, including CAD and Mobile Data Systems, the following audit methods shall be used: 4.2.1.1 The CAD System records messaging in 24-hour files containing all communications through the CAD Message Switch, which includes CAD System messaging and Mobile Data
• http://www.fcc.gov/pshs/docs/emergency-information/Pandemic_Comms_Impact_Study_%28December%202007%29.pdf
  • Background 1-1 1.2.1 Pandemic Influenza 1-1 1.2.2 Telecommuting 1-1 1.3 Problem Definition 1-2 1.4 Scope 1-2 1.5 Document Organization 1-3 2 Stakeholder Involvement 2-1 3 Methodology 3-1 3.1 Potential Congestion Points 3-1 3.2 Recommended Preparations 3-1 3.3 Modeling 3-1 4 Potential Congestion Points 4-1 4.1 Assumptions 4-1 4.1.1 Pandemic Influenza 4-1 4.1.2 Network User Behavior 4-1 4.1.3 Communications Infrastructure 4-1 4.2 Enterprise Networks 4-3 4.2.1 Pandemic Preparedness 4-3 4.2.2 Potential Congestion Points 4-3 4.3 Residential Internet Access Networks 4-4 4.3.1 Pandemic Preparedness 4-4 4.3.2 Potential Congestion Points 4-5 5 Recommended Preparations 5-1 5.1 Short Term 5-1 5.2 Long Term 5-3 6 Outstanding Issues 6-1 6.1 Worst Case 6-1 6.2 Cyber Security 6-1 7 Modeling 7-1 v 7.1 Purpose 7-1 7.2 Scope
• http://www.fcc.gov/pshs/docs/emergency-information/Pandemic_Comms_Impact_Study_(December%202007).pdf
  • Background 1-1 1.2.1 Pandemic Influenza 1-1 1.2.2 Telecommuting 1-1 1.3 Problem Definition 1-2 1.4 Scope 1-2 1.5 Document Organization 1-3 2 Stakeholder Involvement 2-1 3 Methodology 3-1 3.1 Potential Congestion Points 3-1 3.2 Recommended Preparations 3-1 3.3 Modeling 3-1 4 Potential Congestion Points 4-1 4.1 Assumptions 4-1 4.1.1 Pandemic Influenza 4-1 4.1.2 Network User Behavior 4-1 4.1.3 Communications Infrastructure 4-1 4.2 Enterprise Networks 4-3 4.2.1 Pandemic Preparedness 4-3 4.2.2 Potential Congestion Points 4-3 4.3 Residential Internet Access Networks 4-4 4.3.1 Pandemic Preparedness 4-4 4.3.2 Potential Congestion Points 4-5 5 Recommended Preparations 5-1 5.1 Short Term 5-1 5.2 Long Term 5-3 6 Outstanding Issues 6-1 6.1 Worst Case 6-1 6.2 Cyber Security 6-1 7 Modeling 7-1 v 7.1 Purpose 7-1 7.2 Scope
• http://www.fcc.gov/realaudio/tr062402.pdf http://www.fcc.gov/realaudio/tr062402.txt
  • at minority owned station. 100 Heritage Reporting Corporation (202) 628-4888 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 As reported by the Minority Media and Telecommunications Council, just over half of the minorities in radio work for minority owned stations. Minorities only own 4.2 percent of the radio stations. Thus, minority owned stations simply don't have enough top positions to which young people coming into the industry can aspire to. The record of this proceeding includes extensive evidence of the gross under deployment of minorities and women and under utilization of their talent in our industry. For example, EEOC data for 2000 discloses that
• http://www.fcc.gov/transaction/aol-tw/tseng_comment051100.pdf
  • TO OPEN ACCESS.......................................................9 SECTION 2.5. CURRENT STATUS OF THE POLICY DEBATE..............................................................................................10 SECTION 2.6. RECENT ACTIVITY..................................................................................................................................12 SECTION 3. OPEN ACCESS CABLE NETWORK ARCHITECTURES.................................................................13 SECTION 3.1. HYBRID FIBER-COAX CABLE NETWORK..................................................................................................13 SECTION 3.2. OPEN ACCESS TECHNOLOGY OPTIONS....................................................................................................14 SECTION 3.3. POINT TO POINT PROTOCOL OVER ETHERNET (PPPOE)............................................................................16 SECTION 3.4. LAYER 2 TUNNELING PROTOCOL (L2TP)................................................................................................17 SECTION 4. INCREMENTAL CAPITAL COST MODEL.......................................................................................19 SECTION 4.1. BACKGROUND........................................................................................................................................19 SECTION 4.2. METHODOLOGY.....................................................................................................................................19 SECTION 4.3. GENERAL PARAMETERS AND ASSUMPTIONS FOR 3 SCENARIOS (U.S., BOSTON, PORTLAND)......................20 SECTION 4.4. EQUIPMENT DESCRIPTION AND PRICES....................................................................................................21 SECTION 4.5. BANDWIDTH OVERHEAD........................................................................................................................22 SECTION 4.6. PROJECTED PENETRATION RATES AND ONE-TIME AND ONGOING CAPITAL COSTS...................................23 SECTION 4.7. INCREMENTAL CAPITAL COST SUMMARY................................................................................................24 SECTION 4.7.1. SCENARIO #1 (U.S.)............................................................................................................................24 SECTION 4.7.2. SCENARIO #2 (BOSTON).......................................................................................................................25 SECTION 4.7.3. SCENARIO #3 (PORTLAND)...................................................................................................................26 SECTION 4.8. SENSITIVITY ANALYSIS FOR
• http://www.fcc.gov/transaction/att-comcast/bellsouth_exhibit1.pdf
  • 2 2.1 2.2 2.3 2.4 Defining Broadband Access Broadband and Digital Convergence Broadband and Wireless Networks Next Generation Broadband Implications of Broadband Definition B & J 3 3 3.1 3.2 3.3 3.4 3.5 Primary Policy Goals & Objectives Promoting Intermodal Competition Technology Neutrality Policies Facilities-Based Competition Widespread Deployment of Broadband Access Eliminating Regulatory Obstacles A & D 10 4 4.1 4.2 4.3 4.4 4.5 Disincentives for Investment in Broadband Access Need for Investment in Broadband Access Disincentive Effects of Regulated Rates for Interconnection, Resale and UNEís Disincentive Effects of TELRIC Prices Disincentive Effects of Investment Returns Disincentive Effects of Retail Price Regulations C, E & G E.1. E.4 E.2 & 3 15 5 Regulatory Policies for Broadband Access & Services F,
• http://www.fcc.gov/transaction/att-comcast/oppwp35.pdf
  • Staff, or any Commissioner. Given the preliminary character of some titles, it is advisable to check with the authors before quoting or referencing these working papers in other publications. i Table of Contents EXECUTIVE SUMMARY......................................................................................1 1. INTRODUCTION............................................................................................7 2. METHODOLOGY - EXPERIMENTAL ECONOMICS.....................................9 3. EXPERIMENTAL DESIGN...........................................................................14 3.1 Treatment Variables..............................................................................................................14 3.2 Experiment Institution..........................................................................................................17 3.3 Performance Measures..........................................................................................................22 4.0 EXPERIMENT RESULTS..........................................................................26 4.1 Economic Efficiency..............................................................................................................27 4.2 Buyerís Bargaining Power....................................................................................................28 4.3 Buyer Surplus........................................................................................................................34 4.4 Seller Profits and Losses........................................................................................................36 4.5 Regression Analysis ñ CAP MFN Treatment Data...............................................................40 5.0 CONCLUDING COMMENTS.....................................................................50 APPENDIX A: ECONOMIC THEORY................................................................54 A.1 Traditional Oligopsony/Oligopoly Theory............................................................................54 A.2 Some Solutions Based on Cooperative Game Theory...........................................................55 A.2.1 The ìNash Bargainingî Solution......................................................................................57 A.2.2 The ìShapley Valueî Solution..........................................................................................57 A.2.3 The ìCoreî Solution........................................................................................................58 A.3 Illustration of the Cooperative Solutions for a
• http://www.fcc.gov/transaction/att-comcast/qwest_exparte062102.pdf
  • that it was not technically feasible to interconnect multiple ISPs (which is now belied by the fact that, under government pressure, cable operators seem to have overcome those technical difficulties).33 Furthermore, a proper assessment must look at the medium- to long-term consequences of the merger, since the merger will last indefinitely. Obviously, those consequences cannot be empirically verified in advance. 4.2. IT'S ALL ONE BIG MARKET? AT&T/Comcast and Shelanski argue that narrowband and broadband Internet access are in the same market in a transparent effort to "dilute" cable's market share. The Commission has correctly found to the contrary.34 The merged entity will control an unprecedently large share of the broadband Internet access market and be able to exert significant market power
• http://www.fcc.gov/transaction/comsat-telenor/fcc01-369.pdf
  • and NOTICE 4.1 Access to Information: In response to reasonable requests made by the FBI or the DOJ, Telenor shall provide in the United States access to information concerning technical, physical, management, or other security measures and other reasonably available FEDERAL COMMUNICATIONS COMMISSION FCC 01-369 37 information needed by the FBI or the DOJ to assess compliance with this Agreement. 4.2 Visits and Inspections: The FBI and the DOJ may visit any communications facility of Telenor in the United States and may inspect any part of the Domestic Communications Infrastructure in the United States for the purpose of verifying compliance with the terms of this Agreement. Such inspections shall be reasonable in number and be conducted during normal business hours upon
• http://www.fcc.gov/transaction/echostar-directv/nab4_petition020402.pdf
  • 3: ANNUAL LOSS IN CONSUMER WELFARE FROM THE PROPOSED MERGER Geographic Market Deadweight Loss ($ millions) Wealth Transfer to DBS Providers ($ millions) Total Consumer Welfare Loss ($ millions) NPV Over Next Five Years ($ millions) Area Not Passed by Cable (1) 378.6 151.5 530.1 2,285.9 Areas Passed by Cable (Cournot) 17.9 143.1 161.0 694.3 Areas Passed by Cable (Bertrand) 4.2 169.8 174.0 750.3 Areas Passed by Cable (Collusion) 781.5 455.2 1,236.6 5,332.4 Total (1 + Cournot) 396.5 294.6 691.1 2,980.1 Total (1 + Bertrand) 382.8 321.3 704.1 3,036.2 Total (1 + Collusion) 1,160.1 606.7 1,766.7 7,618.2 Notes: I assume that 29 percent of DBS customers reside in areas not passed by cable television systems. See Comments of DirecTV, Inc. in
• http://www.fcc.gov/transaction/nbc-telemundo/exhibit6.pdf
  • venture, limited liability company or other business association or entity, whether incorporated or unincorporated. (c) S Sub owns, beneficially and of record, all of TNG's Class B Membership Interests, representing 33% of all of TNG's membership interests. Except for its equity interests in TNG and its equity interests in the Company, S Sub does not own any other material assets. 4.2 Title. S Sub directly owns 33% of the membership interests in TNG, free and clear of all Liens. S Sub does not have and is not bound by any outstanding subscriptions, options, warrants, calls, commitments or agreements of any character calling for the purchase, sale, return, redemption or issuance of any shares of its common stock or any other equity
• http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304C98.PDF
  • N/A 1281K$ SPEC. COE CAT. 4.13 EXC. CAT. EQPT. - TWX N/A N/A N/A N/A 1282# TWX MIN. OF USE FOR ALLOC. N/A N/A N/A N/A 1283K$ TOT. SPEC. COE CAT. 4.13 N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304F98.PDF
  • N/A 1281K$ SPEC. COE CAT. 4.13 EXC. CAT. EQPT. - TWX N/A N/A N/A N/A 1282# TWX MIN. OF USE FOR ALLOC. N/A N/A N/A N/A 1283K$ TOT. SPEC. COE CAT. 4.13 N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304P98.PDF
  • NOTE:Category4.13COEisdividedintobasicandspecialifamountsofexchange andinterexchangespecialcircuitequipmentaresignificantpursuanttoSection 36.126(b)(4).IfthereportingcarrierdoesnotsegregateCategory4.13COEintobasic andspecial,itmustreportallsuchCOEasbasic. (a)BasicCategory4.13COE 1270 TotalnumberofworkingloopsusedtoallocatebasicCategory4.13COEpursuant toSections36.126(c)(3)and36.154(a). 1271 NumberofworkingloopsthatareassociatedwithprivatelinesandWATSlines pursuanttoSections36.126(c)(3)and36.154(a). FCCReport43-04-Rep.Def.RowInstructions December1998 Page109of158 1272 Numberofworkingloopsthatareassociatedwithsubscriberorcommonlinesthatare jointlyusedforlocalexchangeserviceandexchangeaccessforstateandinterstate interexchangeservicespursuanttoSections36.126(c)(3)and36.154(a). 1273 AveragecostperworkingloopthatisusedtoallocatebasicCategory4.13COE pursuanttoSections36.126(c)(3)and36.154(a). 1274 BasicCategory4.13COEthatisassociatedwithprivatelinecircuitsandWATS circuitsandisdirectlyassignedpursuanttoSections36.126(c)(3)and36.154(a)and (b). 1275 BasicCategory4.13COEthatisassociatedwithsubscriberorcommonlinesthatare jointlyusedforlocalexchangeserviceandexchangeaccessforstateandinterstate interexchangeservicesandwhichinvestmentisallocatedpursuanttoSections 36.126(c)(3)and36.154(c)-(f). 1276 Loopallocationfactor(inpercent)usedtoallocatebasicCategory4.13COE subscriberorcommonlinespursuanttoSections36.126(c)(3)and36.154(c)-(f).For thecalculationoftheloopallocationfactor,seeSection36.154(c)-(f)andinfrarows 1456-1459. 1277 TotalbasicCategory4.13COE,totalofRows1274and1275. (b) SpecialCategory4.13COE 1280 SpecialCategory4.13COEthatisassociatedwithprivatelinecircuitsandisdirectly assignedpursuanttoSections36.126(c)(3)and36.154(a)and(b).SeealsoGlossary, Part36. 1281 SpecialCategory4.13COEthatisassociatedwithTWXcircuitsandisallocated pursuanttoSections36.126(c)(3)and36.155. 1282 TWXminutes-of-useusedtoallocatespecialCategory4.23COEthatisassociated withTWXcircuitspursuanttoSections36.126(c)(3)and36.155. 1283 TotalspecialCategory4.13COE,totalofRows1280and1281. 1290 TotalCategory4.13COE,totalofRows1277and1283,includingCategory4.13 COEthatisdirectlyassignedpursuanttoSection69.304andthePart69 ReconsiderationOrder,atpara.48. 1300 TotalCategory4.1COE,totalofRows1224,1260and1290. FCCReport43-04-Rep.Def.RowInstructions December1998 Page110of158 b)Category4.2COE,InterexchangeCircuitEquipment (1) Category4.21COE,InterexchangeCircuitEquipmentFurnishedto AnotherCompanyforInterstateUse 1310 Category4.21COEthatisdirectlyassignedpursuanttoSections36.126(e)(1)and 69.305andthePart69ReconsiderationOrder,atpara.48. (2) Category4.22COE,InterexchangeCircuitEquipmentUsedfor WidebandService 1320 Category4.22COEthatisassociatedwithprivatelinecircuitsandisdirectlyassigned pursuanttoSections36.126(e)(2)and36.156(b). 1321 Category4.22COEthatisassociatedwithmessagecircuitsandisdirectlyassigned pursuanttoSections36.126(e)(2)and36.156(b). 1322 Category4.22COEthatisjointlyusedandisallocatedpursuanttoSections 36.126(e)(2)and36.156(b). 1323 Conversation-minute-kilometersusedtoallocatejointlyusedCategory4.22COE pursuanttoSections36.126(e)(2)and36.156(b). 1324 TotalCategory4.22COE,totalofRows1320,1321,and1322includingCategory 4.22COEthatisdirectlyassignedpursuanttoSection69.305andthePart69 ReconsiderationOrder,atpara.48. (3) Category4.23COE,AllOtherInterexchangeCircuitEquipment NOTE:Category4.23COEisdividedintospecialandbasicifamountsofexchange andinterexchangespecialcircuitequipmentaresignificantpursuanttoSection 36.126(b)(4).IfthereportingcarrierdoesnotsegregateCategory4.23COEintobasic andspecial,itmustreportallsuchCOEasbasic. (a)BasicCategory4.23COE 1330 TotalterminationsusedtodeterminetheamountofbasicCategory4.23COEpursuant toSection36.126(e)(3)(i). 1331 TerminationsusedtodeterminetheamountofprivatelinebasicCategory4.23COE investmentpursuanttoSection36.126(e)(3)(i). 1332 Terminationsusedtodeterminetheamountofdirectlyassignedmessagebasic Category4.23COEpursuanttoSection36.126(e)(3)(i). FCCReport43-04-Rep.Def.RowInstructions December1998 Page111of158 1333 TerminationsusedtodeterminetheamountofjointlyusedmessagebasicCategory 4.23COEpursuanttoSection36.126(e)(3)(i). 1334 TerminationsusedtodeterminetheamountofTWXbasicCategory4.23COE pursuanttoSection36.126(e)(3)(i). 1335 AveragecostperterminationthatisusedtodeterminethecostofbasicCategory4.23 COEpursuanttoSection36.126(e)(3)(i). 1336 BasicCategory4.23thatisassociatedwithprivatelinecircuitsandisdirectly assignedpursuanttoSection36.126(e)(3)(i). 1337 BasicCategory4.23thatisassociatedwithmessagecircuitsandisdirectlyassigned pursuanttoSections36.1(c)and36.126(e)(3)(i). 1338
• http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304PF98.PDF
  • N/A 1281K$ SPEC. COE CAT. 4.13 EXC. CAT. EQPT. - TWX N/A N/A N/A N/A 1282# TWX MIN. OF USE FOR ALLOC. N/A N/A N/A N/A 1283K$ TOT. SPEC. COE CAT. 4.13 N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/1999PDFs/4304C99.PDF
  • N/A N/A N/A N/A N/A N/A N/A 1282# TWX MIN. OF USE FOR ALLOC. N/A N/A N/A N/A N/A N/A N/A 1283K$ TOT. SPEC. COE CAT. 4.13 N/A N/A N/A N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/1999PDFs/4304P99.PDF
  • N/A N/A N/A N/A N/A N/A N/A 1282# TWX MIN. OF USE FOR ALLOC. N/A N/A N/A N/A N/A N/A N/A 1283K$ TOT. SPEC. COE CAT. 4.13 N/A N/A N/A N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/2000PDFs/4304C00.PDF
  • TOTAL BASIC COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A N/A N/A (b) Special Category 4.13 COE 1280K$ SPEC. COE CAT. 4.13 EXC. CKT. EQPT. - ASSG. PL N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/2000PDFs/4304P00.PDF
  • TOTAL BASIC COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A N/A N/A (b) Special Category 4.13 COE 1280K$ SPEC. COE CAT. 4.13 EXC. CKT. EQPT. - ASSG. PL N/A N/A N/A N/A 1290K$ TOT. COE CAT. 4.13 EXC. LINE CKT. EQPT. INV. N/A N/A 1300K$ TOT. COE CAT. 4.1 EXC. LINE CKT. EQPT. INV. N/A N/A b) Category 4.2 COE - Interexchange Circuit Equipment (1) Category 4.21 - Interexchange Circuit Equipment Furnished to Another Company for Interstate Use 1310K$ CAT. 4.21 FURN. TO OTHERS N/A N/A N/A N/A N/A (2) Category 4.22 COE - Interexchange Circuit Equipment Used for Wideband Service 1320K$ COE CAT. 4.22 IX. CKT. EQUIP. (WDBD.) - ASSG. PL N/A N/A N/A N/A 1321K$ COE CAT.
• http://www.fcc.gov/wcb/armis/documents/2001PDFs/4304C01.PDF
  • N/A N/A N/A 1339# Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393# Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A 1410Total COE Investment N/A
• http://www.fcc.gov/wcb/armis/documents/2002PDFs/4304c02.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2002PDFs/4304p02.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2003PDFs/4304c03.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2003PDFs/4304p03.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2004PDFs/4304c04.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2004PDFs/4304p04.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2005PDFs/4304c05.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2005PDFs/4304p05.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2006PDFs/4304c06.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2006PDFs/4304p06.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2007PDFs/4304c07.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/2007PDFs/4304p07.pdf
  • Conversation Minutes N/A N/A N/A N/A N/A N/A N/A 1342 Total COE Cat. 4.23 Basic IX Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A N/A N/A 1350 COE Cat. 4.23 Spl. IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1370 Total COE Cat. 4.23 IX Ckt. Eqpt. Inv. N/A N/A 1380 Total COE Cat. 4.2 IX Ckt. Eqpt. Inv. N/A N/A 1392 COE Cat. 4.3 Host/Remote Ckt. Eqpt. ­ Joint Use N/A N/A N/A N/A N/A N/A N/A 1393 # Minutes of Use Kilometers N/A N/A N/A N/A N/A N/A N/A 1394 Total COE Cat. 4.3 COE ­ Host/Remote Ckt. Eqpt. Inv. N/A N/A 1400 Total COE Cat. 4 ­ COE Ckt. Eqpt. Inv. N/A
• http://www.fcc.gov/wcb/armis/documents/order_da_91_143.pdf
  • ASB 36/69 I II I N/A I ~/A I N/A I / FCC Report 43-04 -Report Definition -Form FCC REPORT 43-04 ARMIS ACCESS REPORT November 1990 Rev. COMPANY : STUDY AREA: PERIOD: COSAI xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxx From mmm yyyy To mmm yyyy xxx x Page 11 of 90 Approved by QMB 3060--0395 Expil:es 10/31/92 xxxxxxxxxxxx VERSION SUBM:[SSION X TABLI~ I PAGE 4.2 OF 30.3 TABLE I -SEPARATIONS AND ACCESS TABLE (Dollars in Thousands) I I Total I Traffic Sensitive I Total I Special I I Category ICommon Linel SWitching I BqualAccesl I Transport IXnformationlTraffic Senl Access I Row I la) I Ii) I Ii) I Ik) I 11) 11m) I In) I 10) I c) Auxiliary Service Boards 1130 ISeparate DA 36/69
• http://www.fcc.gov/wcb/cpd/Nanc/wknggrp.doc
  • (2) uniformity in the provision of LNP data (LNP Order, ¶91); (3) cost effective implementation of LNP (LNP Order, ¶¶91, 93, 95); (4) consistency in LNPA administration (LNP Order, ¶93); (5) LNPA compliance with NANC-determined technical and functional proficiency standards (LNPA Order, ¶¶95, 99); and (6) regionalized LNPA deployment within the FCC deployment schedule (LNP Order, ¶91 and Appendix F). 4.2 Mechanics of the LNPA Selection Process 4.2.1 The LNPA Selection Working Group reviewed the state/regional selection process and determined that each and every action undertaken as part of the LNPA selection process conforms to, and thus satisfies, the Criteria. These actions consist of a sequence of carefully planned steps taken by telecommunications service providers interested in advancing implementation of LNP
• http://www.fcc.gov/wcb/ppd/depreciation/documents/fcc00306.pdf
  • WORK EQ 5.6 0 48.1 9.3 2121 BUILDINGS 27.0 0 22.4 2.9 2122 FURNITURE 5.2 5 46.6 9.3 2123.1 OFFICE SUPPORT EQ 3.5 0 6.8 26.6 2123.2 COMPANY COMMUN EQ 4.6 0 66.4 7.3 2124 GEN'L PURPOSE COMPUTERS 2.7 0 93.8 2.3 2212 DIGITAL ELECTRONIC SW 7.0 0 39.3 8.7 2220 OPERATOR SYSTEMS 4.9 0 39.7 12.3 2231 RADIO SYSTEMS 4.2 0 51.1 11.6 2232 CIRCUIT EQ 5.8 0 40.7 10.2 2362 OTHER TERMINAL EQ 2.2 0 62.3 17.1 2411 POLES 13.3 -97 73.2 9.3 2421 AERIAL CABLE METALLIC 10.2 -17 66.0 5.0 2421 AERIAL CABLE NONMETAL 13.9 -10 38.9 5.1 2422 UG CABLE METALLIC 14.1 -22 47.9 5.3 2422 UG CABLE NONMETAL 13.8 -10 31.2 5.7 2423 BURIED CABLE METALLIC
• https://esupport.fcc.gov/index.htm?job=upload_help_2
  • [6]E-Filing [7]Initiatives [8]Consumers [9]Find People Support Attachment Help Maximum Attachments and Size You can attach up to six (6) files. The attached files can have up to a total file size of 10.0MB each. * [10]Accepted Word Processing Formats * [11]Accepted Spreadsheet Formats * [12]Accepted Presentation Formats Accepted Word Processing Formats * ASCII Text * ANSI Text * Applix Words v4.2 * Applix Words v4.3 * Applix Words v4.4 * Executables * HTML v1.x * HTML v2.x * HTML v3.x * HTML v4 * IBM DCA/RFT vSC23-0758-1 * IBM Displaywrite v4 * IBM Displaywrite v5 * Lotus AMI Pro v2 * Lotus AMI Pro v3 * Lotus AMI Professional Write Plus * Lotus Word Pro v96 * Lotus Word Pro v97